KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2334
Entry
SSPA2334          CDS       T00756                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
KEGG Orthology (KO) [BR:sek00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sek02044]
    SSPA2334
Secretion system [BR:sek02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SSPA2334
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CAR60565
UniProt: A0A6C7I1B3
Position
2597849..2598844
AA seq 331 aa
MTGALDQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIA
QVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQF
WQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRN
PDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQSSVLGNGALIGQAVPDMQY
KFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCWEIELQLKPHAAPPAVIGGA
QRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaccggcgctctcgaccaggcgcagaaaaccccctggcgttacggattcctgaacctg
atgcggcgcgtggatgcccagctctgtgatactccggcaggcagtatctggcagccacgg
atggaaaaattccgtctgggacagacgccgacgatgacctttgcaccacgggaaatcgcc
caggtcagctggcaggatggacgcctgcacctgagcctgtacagcctcggactatggggg
ccaaacggcccgttgccgctgcactataccgagctggcgctaaaccgctcagagagtcgt
cacgatccgacgctggttcatttttccaatatttttcaccaccgctggctgacgcagttc
tggcaggcatggcgcagcgcccagtccgctggtggcgggctggacaaaccggaacacgac
cgttttgcgttttatatcgccagtctcagcgggcaggatctacgggaaagcgccgaaagc
ccgctgtcagatcatgttcgcctggcagcctccgcccatctggtacgcgagtcgcgcaat
cctgacgggctggccgccacgctggcgcactattttagcgtaccttttgcggtgaaagag
ttcgccctacactggataacggtggcgaacgatgaaatcacccgtctgggcacgcccgcg
cagtcttcggtgctgggcaacggggcgcttatcggccaggccgtaccggatatgcagtac
aaattccggctaattatcggcccgctcacgctggaggattacctgcgttttctgcccggc
ggcaacaatctgcccgtgctgacagaactggtgcgtacgttcattggttttgaatattgc
tgggaaattgagctgcagttgaagcctcatgccgcaccgcctgcggtgatcggcggcgcg
cagcggcttggctggacggcctgggcaggtaaagccatgcatgaccgtccggtgaccggc
atgatttttgaacctgaacacggcttaacccactga

DBGET integrated database retrieval system