KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2877Help
Entry
SSPA2877          CDS       T00756                                 

Definition
(GenBank) G/U mismatch-specific DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sek00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SSPA2877
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sek03400]
    SSPA2877
Enzymes [BR:sek01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     SSPA2877
DNA repair and recombination proteins [BR:sek03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SSPA2877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: CAR61124
UniProt: B5BG24
Position
complement(3184504..3185010)
Genome map
AA seq 168 aa AA seqDB search
MVKDILAPGLRVVFCGINPGLSSANTGFPFAHPANRFWKVIHLAGFTDRQLKPEEAEKLL
DFRCGVTKLVDRPTVQATEVKLHELRSGGRNLIEKIEDYQPAALAVLGKQAFEQGFSQRG
IAWGKQKIAIGATMVWVLPNPSGLNRIKTEKLVEAYRELDQALIMRGL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggacatactggcgccagggctacgggtggttttttgcggcatcaatccggga
ctctcctcggcgaataccggctttccgtttgcgcatcccgcgaatcgtttttggaaagtt
attcatttggccggtttcaccgatcgacagttgaaaccggaagaggcggaaaaattactg
gattttcgctgcggggtaacgaaactcgtcgaccgaccgacggtacaagcgactgaggtg
aagttgcatgaattacgtagcggcggacgaaacctgattgaaaaaatagaggactaccag
cccgcggcgctggcggtgcttggtaaacaggcttttgaacaggggttcagccagcgcggt
atcgcctggggtaaacaaaagatcgccattggcgcgacgatggtgtgggtgttgccgaat
cccagtggcttaaaccgaattaaaacggaaaaactggtcgaggcctatcgcgaactggat
caagcgctcattatgcgtgggctatag

DBGET integrated database retrieval system