KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1902
Entry
SPUL_1902         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54231
Position
complement(1890709..1890915)
AA seq 68 aa
MFFLHLRTDYGMPCNKKLGNHFTRRKFFEKHFFKMEYRSILLLWLFQDDVVFIRNILKDI
LMNGVLFF
NT seq 207 nt   +upstreamnt  +downstreamnt
atgttttttttgcatctccgtacagactatggaatgccgtgtaataaaaagcttggtaat
cattttacgcgcagaaaattttttgagaagcactttttcaaaatggaatacaggagtatt
cttcttttgtggttatttcaggatgacgttgtttttataaggaatatcttaaaagatatt
ttaatgaatggtgttttgtttttttag

DBGET integrated database retrieval system