KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1904
Entry
SPUL_1904         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: VipB
Other DBs
NCBI-ProteinID: AET54233
Position
1891473..1891685
AA seq 70 aa
MGLREETSRTDDAITQAVIRLFISQTGDINTETLEVLVAALDQRIGCLMDEIIHINGYQQ
MKPHWRKVFH
NT seq 213 nt   +upstreamnt  +downstreamnt
atgggcttgcgggaagagacctccagaaccgatgacgcaataacgcaggcagtgatccgg
ttatttatcagtcagacaggcgacatcaacacagaaacactggaggtattggtcgcggcg
cttgaccagaggatcggatgtctgatggatgaaatcatccatatcaacgggtaccagcag
atgaagccacactggcgaaaggtgttccactga

DBGET integrated database retrieval system