KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1905
Entry
SPUL_1905         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1905
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1905
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AET54234
Position
1891734..1893206
AA seq 490 aa
MSLQEEELVSTRTEQGSHAPSLLDEIMAQTRIQPGADGYDIARQGVTAFIASLLQSTSPA
EPVNKLAVDSMIADIDARISRQMDAIIHAPQFQQLESFWRSMKALVDRVDFRENIKVHVL
HVTKAELLEDFEFAPEITQSGFYKHVYSSGLGQFGGEPIAAVLGAYEFKNTTPDMKLLNY
VSAVGAMAHAPFLSSVSPEFMGLKSWTELPNIKDLYAIFEGPAYTKWRALRDSEDSRYLG
LTAPRFLLRQPYSATENPIKSFNYAEDVSHSHEHYLWGNTAWMLASNIADSFAKYRWAPN
IIGPQSGGAVKDLPVHLYESMGQIQAKIPTEVLITDRREFELAEEGFITLTMRKNSDNAA
FFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNIWVRQYVADQENPPADVRSRKPLRGAKVEVLDVDGEPGWYQVAISARPHFKYMGASF
ELSLVGRLDK
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtctttacaggaagaagaacttgtttccacccgcactgaacagggaagccatgccccg
tcgttgcttgatgaaatcatggcacaaacccgtatccagcccggcgctgacggttatgat
attgcccgtcagggcgtaacggcttttattgccagcctcctgcaatccacttcacctgca
gaacccgtaaacaaactggccgtggacagcatgattgcggacatcgacgcccgtatcagc
cgtcagatggatgctattattcacgcccctcagtttcagcaactggagtcgttctggcgt
tcaatgaaagcgctggtcgatcgcgttgattttcgtgagaatattaaggtgcatgtcctc
catgtcaccaaagcggaattgctggaagatttcgagttcgcgccggagattacccagtcc
ggcttctataagcatgtttattccagcgggcttgggcagtttggcggcgaaccgattgcg
gctgtgctgggcgcatatgagttcaaaaataccacgccggatatgaagctgctgaactat
gtcagcgccgtcggcgcaatggctcacgcgccgttcctttcttccgtgtcgccggagttt
atgggcctgaaatcatggaccgagctgcccaatatcaaggatctctacgccatttttgaa
ggtccggcctacacaaaatggcgcgccctgcgtgattccgaagattcccgctacctggga
ctgaccgcgccgcgttttctgcttcgccagccctattccgcgaccgaaaacccgattaaa
agcttcaactacgccgaagatgtgagccacagccacgagcattatttgtggggcaatacc
gcctggatgctggccagtaatatagccgattcgttcgcgaaataccggtgggcgcccaat
attatcgggccgcagagcggcggcgcagtaaaagatctgccggtacatttatatgagtca
atggggcagattcaggccaagatcccgacggaggtgttgatcaccgaccgccgtgagttc
gagctggccgaagaggggttcatcaccctgaccatgcgtaaaaacagcgataatgcggcg
tttttctcggctaacagcgttcagaaacccaagcattttccgggcaaagacgccgagacc
aactacaagctgggtacgcagttgccttatctgttcattattaaccgcctcgcgcactac
attaaggtgctgcaacgcgagcagcttgggtcgtggaaagagagaagcgatctggagcgg
gagctgaatatttgggtgcgccagtatgtcgccgatcaggagaatccgcctgctgatgtc
cgcagccgtaagccgctgcgtggcgctaaagtggaggtgctggatgtggacggcgagccg
ggctggtatcaggtggcgatttccgcaaggccgcactttaaatatatgggcgcgtcgttt
gaattgtctttagtcggacggttagataagtga

DBGET integrated database retrieval system