KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1906
Entry
SPUL_1906         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1906
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1906
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AET54235
Position
1893203..1893619
AA seq 138 aa
MIPAREKPAGSLFERLENPPARNWREGSNIEAFRQSIRHSLRNILNTRSGSCRGTPGLGI
EEPEGSDNYRSAMSQAIVQCIERYEPRISHAEVRAILPQAASPQEIIFRITAWVTFNDID
DVLEFDMAPDGSQHYRVE
NT seq 417 nt   +upstreamnt  +downstreamnt
gtgataccggcgcgcgaaaagcctgccggatcgctgtttgagcgtctggaaaaccctcct
gccagaaactggcgggagggcagtaatatagaggcgttcaggcagtccattcgccatagt
ctgcgcaatatcctgaacacccgctccggcagttgtcggggaacaccggggctgggtatt
gaagagccggaagggtcggataattaccgcagcgccatgagccaggccatcgtgcagtgt
attgagcgttatgaaccccggatttcgcacgcggaggtccgggcaatcctgccacaggcc
gccagcccacaggagataatttttcgtatcaccgcctgggtgacatttaacgatatcgac
gatgtgctggagtttgatatggcaccggacggtagtcagcattatcgggtggagtag

DBGET integrated database retrieval system