KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1907
Entry
SPUL_1907         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1907
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1907
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AET54236
Position
1893624..1895477
AA seq 617 aa
MEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVAFLTGNLRQKI
EDEFPELTHGLIRMLWPNYLRPVPSMTLIEYTPDMDKTSVPVLIPRNEQFTTGAKGTQGN
PVLSAYSGNEHDVAPPCTFTLCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFAT
LDLNRLRFWLGNDDNYTRYQLYLWFCEYLQGAELMAGGQSIPMPEFMLKAVGFESEDAML
PWPGNVHSGYRILQEFFCYADSFLFFDACGIPALPDRLKENRFTLRLRFSRPLPADIRLR
DDSLRLYCAPAINLFSHHAEAITLDHQRQDYALVPSRHFPDHYDIFSVNSVVSQTQGKQR
KADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHRTRTSLFHRGFDHTLAFIHAD
GSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNITRPTRPLWPV
IDGSLHWSLLSAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETT
PVDRLFTGIPVRGLASTLSIHTEPFVCEGEMYLLGAVLSHFLSLYAIVNSFHMLTVVNTE
SQESWKWAERTGQHPLI
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggaattcgaagaacgctattacaggcaggagttggatcacctgcggcagttgagcaag
ctgctggcgaccgaaaagccgcatctggcccggtttctggcagaaaaagaggccgatccg
gatatcgagcgtctgctggagggcgtggcctttctgaccggcaatctgcgccagaaaatc
gaggatgagtttccggagctgacgcacggactgatccggatgctgtggcccaattatctg
cgcccggtgccgtcgatgacgctgattgaatatacgccggatatggataaaacttccgtg
ccggtactgatcccccgtaatgagcagttcacaaccggggcgaaggggactcagggaaac
ccggtattgtctgcgtattccggcaatgagcacgatgtagccccgccctgtacgttcacc
ctgtgccgggatatctggctgttacccgttcaactggatcaggttgaaaatcgcagtacg
ccccgccacggcattattgatattacgtttgccgtcgcaccgggcactgattttgccacg
ctggatctgaacaggctgcgcttctggctgggcaacgatgataactatacccgctatcag
ctttatctgtggttttgtgaatatttacagggcgcagagttgatggcgggcgggcagtcg
atcccgatgcctgaatttatgctgaaagcggtgggttttgagtcagaggacgccatgctg
ccctggcccggcaatgtccacagcggctaccgcattctccaggagtttttctgctacgcc
gacagttttctgtttttcgatgcctgtggcattccggcattgccagacaggttaaaggag
aaccgtttcactctgcggctgcggttttctcgccccttaccggcagatatccggctgcgg
gatgattccctgcgcttatattgtgcgcccgccattaatctgttttcccaccatgccgaa
gccatcacgctggatcatcagcggcaggattacgctctggttcccagccgtcattttccg
gatcattacgacattttttcggttaacagcgtggtgagtcagacgcaggggaagcagaga
aaagcggatcttggacggccggtgatcacagaggccgcgcgccactggcctgcttttgag
agtttccgccaccagatggagtacagccgtaagcgggaagtggtctactggcagcaccgg
accaggacctcgctgtttcaccggggctttgatcataccctggcttttattcatgccgat
ggcagcctcccggatgcctcactgcttaataatgaagtggtttctgtatcgctgacctgc
accaaccgggagctgccggtacagctacggcccggcgatatcaccggtacgacaggtaaa
aacgcgtcggtggcgtcatttcgcaatatcacccgccccaccagaccgctctggccggtg
attgacggcagcctgcactggtcgttgctgtctgccatgaacctgaattatctgtcgttg
ctggatgctgatgcgctcaaacaggtgatcgccaattttgatcgccacgccatccatcat
ccgcagatggcccgtctgtcacagcagaagctggacgccattgaacggctggaaacaacc
ccggttgatcgcctgtttaccggcataccggtgcgcgggctggcgtccaccctgtccatt
catacggagccgtttgtctgcgagggtgaaatgtacctgctgggcgcggtgctgtcgcat
tttctgtcgctgtacgccatcgtcaattcgttccacatgctgaccgtcgttaacacggaa
agccaggagtcatggaaatgggcggaaagaaccgggcaacacccgctcatctga

DBGET integrated database retrieval system