KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1908
Entry
SPUL_1908         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1908
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1908
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AET54237
Position
1895441..1896529
AA seq 362 aa
MGGKNRATPAHLSPDDAPAQDEQRTLREPLFQDACACNFFALSELLHRLASEGGETPVLS
LDTPPAQETIRFQADASLGFPVSDVSALEQDASGLFRMTTTFMGLQGSQSPLPGYYLDHL
AWKSAHEQSPVSDFLDMFSHRLTQFVWHIWRKYRYHVAFRNGGVDAFSQRMYSLVGLGHR
QLRDSLPVNHSKMLAYAGILANPGRSPEIVCTLVAHCFDLNLSDVTLQNWQRRMVDIEPD
QQNSLGCYTIKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSINHLSRKQFLSFLPSGENF
LPLAMFVSFVLRDQLAWDLHLGLAPDQVGIMRLGDNKSALLGWTSFLGEPGEHPSVTIRV
RE
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgggcggaaagaaccgggcaacacccgctcatctgagtccggacgatgctccggcgcag
gatgaacaacgcacgctgcgggagccgttgtttcaggacgcctgcgcctgcaattttttc
gcgctctctgagctgctgcaccggctggcatcagaaggcggcgaaacgccagtgttatcc
ctggatacccctccggcgcaggaaaccattcgtttccaggcggacgccagcctgggattt
ccggtaagcgatgtcagcgcgctggagcaggatgcttccgggttgttccggatgaccacc
acctttatgggattgcagggcagccagtcgcccctccccggctattaccttgatcacctg
gcctggaaatccgcgcacgagcagagtccggtcagcgattttctggatatgttcagccat
cgcctgacgcagtttgtctggcatatctggcgtaagtaccgttaccacgtcgctttccgt
aacggcggcgtggatgcgttctcgcagcggatgtactccctggtggggctgggccaccgg
cagcttcgcgacagtctgcccgttaaccacagcaaaatgctggcctatgccgggatactg
gcaaatccgggacgttcgccggagatcgtctgtacgctggttgcgcactgtttcgattta
aatttatcggacgtgacgctgcaaaactggcagcggcggatggtggatatcgagccggat
cagcagaacagtcttggatgttacacgattaaaaatggcgaaaaactggccgggcgatcg
gtgctgggtaattttgtcctcggtacgcgggttcccgatctcagcggtaaatttcagtta
agtattaaccacctgagccgcaagcagtttctctcgttcctgccgtcaggagaaaatttt
ctgccgctggcgatgtttgtctccttcgtcctgcgcgatcagcttgcctgggatttacac
ctggggctggccccggatcaggtggggattatgcggctgggcgataacaagagcgcgctg
ctgggctggacgtcatttctcggcgagccgggagagcatccctcagtcaccatcagggtc
agggagtaa

DBGET integrated database retrieval system