KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1909
Entry
SPUL_1909         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1909
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   SPUL_1909
SSDB
Other DBs
NCBI-ProteinID: AET54238
Position
1896554..1897840
AA seq 428 aa
MAEEKARQQTLSLHVVNGNELESGRTARCLFTGDGDVGHGSECHWPVQDRHQNVPAKAFS
ISLHDGAFCLHPLASPLWLNQAKVTAASDQVQLRQGDEIQTGHLILRVYLNQGGMRHYDE
EMATPETIVSNHDLLSDTLLSTDGAPEYPGMPSRHQLADTVVNGFSTDPLQVLQAESLTT
RDNPLAGITPARPSAPLSDPAINGGINTPFMDLPSMYADPHDNEEGMSPADAAQRHLAVT
PLLRGLGGSLAVHNTQDADDFLEEAGRTLQAAIQGLLELQQRRNSLSDKHLRPLEDNPLR
LNMDYATALDVLFAEGKSPVHLAAPAAVSESLRNIRHHEEANRAAIVESLRVLLDAFSPQ
SLMRRFVQYRRSHELRKPLDDAGAWQMYCDYYDELASSRQQGFEMLFNEVYAQVYDRVLR
EKQREPEA
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggcggaagaaaaagcgcggcaacagacgctttcactgcatgtcgttaacggtaacgag
ctggagagcggacgtaccgcacggtgtctgttcaccggagacggcgatgtgggccacggc
agcgaatgccactggcctgttcaggaccggcaccagaacgttccggcgaaggcgttcagc
atcagcctgcatgatggcgcattctgcctgcatccgctggcatcgccattatggctgaac
caggctaaagtcacggcggcctcagaccaggtgcagttacgtcagggcgatgagatccag
accgggcatctgatactccgggtttatctgaaccagggcgggatgcggcattacgatgag
gagatggcgacgcctgaaaccatcgtttctaaccacgacctcctgtcggacacgctactg
tccacggacggcgcgccggaatatccgggaatgccgtcccgccatcagctcgcggatacc
gttgttaatggcttttccaccgatccgttgcaggtgctccaggctgaaagtctgaccacc
agggacaatccgcttgcgggtatcaccccggcccggccctccgccccgttatccgatccg
gcgataaacggcgggatcaacacgccgtttatggatctgccgtccatgtatgccgatccg
catgataatgaagagggcatgtcaccggcagacgcggcgcagcgccacctcgccgtcacg
ccgttactgcgcgggctggggggatcgcttgccgtgcataacacccaggacgccgatgat
tttctggaggaggccggaaggacattgcaggcggcgattcaggggttgcttgagctacag
cagcgccgcaacagcctgtcagacaagcatctgcgcccgctggaagataacccgctgcgc
ctgaatatggactacgccacggcgctggacgtgctgtttgccgaagggaaaagcccggta
catctggccgcgcccgccgccgtcagcgagagcctgcgcaatattcgtcatcacgaagaa
gccaaccgcgccgcgattgtggaatcgctgcgcgtgctgctggacgccttctcgccacag
agtctgatgcgccgttttgtgcagtaccgccgcagccacgaactgcgtaaaccgctggat
gatgccggtgcgtggcagatgtactgcgattattacgatgagctggcctccagccgccag
cagggttttgagatgctgtttaacgaagtgtatgcccaggtgtatgaccgggtgttgcgt
gaaaagcagcgggagccggaagcatga

DBGET integrated database retrieval system