KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1910
Entry
SPUL_1910         CDS       T01740                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SPUL_1910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1910
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1910
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AET54239
Position
1897837..1898370
AA seq 177 aa
MTGRGFLAWAMVALFTLALCGCETVKKIGEVIKNPDIQVGKLADQSSQVTITLLTEPDAN
INADGEAAAVDVQLVYLSDDSKFQAADYDQIATTALPDALGKNYIDHQDFSLLPDTMKTL
PPVKLDEKTQFIGVIAYFSDDQTTEWKQIEPVEGTGHNYRLLVHIRQSSIEMKKEDD
NT seq 534 nt   +upstreamnt  +downstreamnt
atgacaggccgtggtttcctcgcctgggcgatggtggcgttgttcaccctcgccttatgc
ggttgtgaaacggtaaaaaaaatcggcgaggtgattaaaaacccggatattcaggtcggt
aagctggcagaccagtcttcgcaggtgacgattacgctgctgacggagccggatgccaat
atcaacgcggacggtgaagcggctgcggtggacgtgcagctggtttatctgagcgatgac
tcaaaatttcaggcggccgactacgaccagatagccaccaccgcactacccgacgcgctg
gggaaaaactatatcgatcaccaggatttcagcctgctgcccgacaccatgaaaaccctg
ccgccggtgaagctggatgagaaaacgcagtttatcggcgtgattgcctatttttccgac
gaccagactacggaatggaagcaaatcgaaccggtagaagggacaggacacaactaccgc
ctgctggtgcatatccggcagagcagtattgaaatgaaaaaagaggatgattaa

DBGET integrated database retrieval system