KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1911Help
Entry
SPUL_1911         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1911
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AET54240
Position
1898373..1899704
Genome map
AA seq 443 aa AA seqDB search
MATTRNKVMWREGTLMRPHHLQQQQRYNDYVNNLRFRAIHDLSWGFTELSLNDELLGQGK
IMIDSASGTLPDGTVFSLPDQDALPDPLHPDSFPDEESRNVYLALPVASDVRGEVSYGQQ
VGRYRLSDASVRDLHSENGDARTLTLGQLTPRIMSGADDMSAYVTLPLCRIKDRRADGSL
MLDENFIPTCQNVYVSARLREFLREVQEAVGGRANDLANRIGSPAQSGIADVAEFMMLQL
LNRNQTRFTHRARRPHLHPEDFYLDLAGLLGELMTFTEPSRLPCPLDVYDHRNLTDTFKT
LLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSRLLQSATFVLAVAAKMETLQLQRQ
FIQQSKISSPEKIRNMVSVQIPGIPLHTLMVAPRQLPYHAGFSYFELDKSGAAWADVAAT
GAVALHVSGTFPDLNMQLWAIRG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgcgaaacaaggtgatgtggcgggaaggaacgctgatgcgtccgcaccat
ctccagcagcaacaacgttataacgattatgtgaataatctgcgtttccgggccattcat
gatttgtcctggggatttaccgagctttccctcaatgatgagctgctgggacagggcaaa
attatgatcgacagcgcgtcgggcaccctgccggacggcaccgtgttttcccttccggac
caggatgcgctccccgatccgctgcatccggacagttttcctgatgaagaaagccgcaat
gtctatctggctttacccgttgccagcgatgtgagaggcgaagtcagttacgggcagcag
gttgggcgttaccggctgagcgatgccagtgtccgggatctgcactccgagaatggcgat
gcccggacgctgacgctgggccagttgaccccccgcattatgagcggagcggacgatatg
agcgcgtatgtcacgttgccgctgtgccgtatcaaagacaggcgtgcggacggctccctg
atgctggatgaaaactttatccctacctgccagaacgtttatgtcagcgcacggctgcgt
gaatttctccgggaagtccaggaagcggttggcggccgggccaatgacctggctaaccgc
attggctctccggcgcaaagcggtattgccgacgttgcggaatttatgatgctgcaactg
ctcaaccgtaaccagacgcggttcacccaccgcgcccgcaggccgcacctccatccggaa
gatttttatctcgatctggccggactgctgggcgagctgatgacatttaccgagccatcc
cgcctgccctgtccgctggatgtctacgatcaccgtaacctgacggacaccttcaaaacg
ctgttgccggaagtgaaacgggcattacataccgtcctgtcgcccagggcggttaacctg
ccgctgcatctgcgcgatggcatctggcaggctgacgtacatgactccaggctgttgcag
tcggccaccttcgtgctggcggtggcggcgaaaatggagacgctgcaactccagcgccag
tttatccagcagtcaaaaatttcctcgccggaaaaaatccgcaatatggtcagcgtgcaa
atccccggcatcccgctgcatacgctgatggtggcgccccgccagcttccgtaccatgcc
ggtttcagctatttcgaactggacaagagcggggccgcctgggcggatgtggcggccacc
ggcgctgtcgccctgcatgtttccggtacgttcccggatctgaacatgcaactgtgggcc
ataagaggataa

DBGET integrated database retrieval system