KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1912
Entry
SPUL_1912         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SPUL_1912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1912
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1912
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AET54241
Position
1899709..1900458
AA seq 249 aa
MDELSLPPLPGYEREGQRQYQLALRGNSLNPMIDAATPLLGMVMRVSGMNSHAMPEHLFT
QVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHN
EAWGGEKVFILLERLMSEPKRYQDLLEFLYICFSLGFRGRAVQDQGEFEQIYRRLYHVLH
KLRGDAPFPLLHQDKKTQGGRYQLIKRLTIRHVLCGGIVVLALFYLFYLLRLDSQTQDIL
HQLNRLLAR
NT seq 750 nt   +upstreamnt  +downstreamnt
atggatgagctgtcactgccccctttacccggatacgagagagaaggccagcgccagtat
cagctggcgctgcgcggcaacagcctgaacccgatgatcgatgccgccaccccgctgctg
gggatggtgatgcgcgtttcgggcatgaacagccatgccatgcctgaacacctgttcacc
caggtggtgacggatgtgcaggcggtggagcagttactccaggagcagggctatgagcct
ggggtgattatctcgtttcgttacatcctgtgtacctttattgacgaggcggcgctgggg
aatggctggtcgaacaaaaacgagtggatcaagcagtcgctgctggtgcatttccataac
gaagcctggggcggtgaaaaggtttttatcctgctggagcgcctgatgagcgaacccaaa
cgctaccaggatctgctggaatttttgtacatctgcttttcgctgggctttcgcgggcgc
gccgtccaggaccagggggagtttgagcagatataccgccgcctgtatcacgtcctgcat
aagctgcgcggcgatgcgccctttccgctgctgcaccaggataaaaaaacccagggcggg
cgctatcagctgattaaacggctgaccatccggcatgttctgtgcggcggcatcgtcgta
ctggcgctgttttatctgttttatctgctgcgtctggacagtcagacgcaggacattctt
catcagttaaaccggctgcttgccaggtaa

DBGET integrated database retrieval system