KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1913
Entry
SPUL_1913         CDS       T01740                                 

Definition
(GenBank) putative clpB-protease
  KO
K11907  type VI secretion system protein VasG
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SPUL_1913
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1913
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1913
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 AAA_22 ClpB_D2-small AAA_7 NACHT RsgA_GTPase Clp_N AAA_24 AAA_18 Sigma54_activat PilJ Rad17 ABC_tran_CTD AAA_6
Other DBs
NCBI-ProteinID: AET54242
Position
1900471..1903062
AA seq 863 aa
MIQIDLATLVKRLAPFAKQALEAAASECMSQQAAEITVAHVLLQMLATPRSDFRVIAERA
EIGADDLRQALTVENYATARSSDSYPSFSPMLVEWLKEAWLLASAEMQQTELPGGVLLLA
LLHSPLRYLPPAAARLLTAINRDLLRQDFAGWTKESAESVILNADGQTASAIADTGDTLL
ARYAKNMTDDARQGRLDPVLCRDNEIDLMIDILCRRRKNNPVVVGEAGVGKSALIEGLAL
RIIAGQVPDKLRDTDIMTLDLGALQAGASVKGEFEKRFKGLMAEVIQSPKPVILFIDEAH
TLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDSGLSAVYEQSHGVLI
DDEALQAAATLSERYLSGRQLPDKAIDVLDTACARVAINLSSPPRQISALTTLRQQCEAE
IRQLEREIRIGLRSDTSRLNEVLAQYDETLSELDALEAAWRQQQTLVQEIIALRKGLLDE
TDATGNDETATPETEAVGSDDESVTAPPEAEPEISPAARLAQLTAELDALHHTQLLVSPH
VDKKQIASVIAEWTGVPLNRLSQNEMSVITDLPQWLGDTIKGQALAIKHLHKHLLTARAD
LRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSP
PGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCK
NVVFFLTSNLGYQVIVEHADNPEAMQEALYPVLADFFKPALLARLDNVLRARFGAEVVIE
PEVTDEIMQRVTRAENGARMLESVIDGEMLPPLSLLLLQKMAANIAIARITLGVANGAFT
ADVEDVPDEDTQPVAEAEDEAVL
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgatccagattgacttagccaccctggtaaaacggcttgctcccttcgcgaaacaggcg
ctggaagcggcggcgtcggagtgtatgagccagcaggcggcagaaattaccgtcgcgcat
gtgctgctacagatgctggcgaccccgcgcagcgactttcgggtgattgccgaacgtgcg
gagatcggcgccgatgatttacgccaggcgctgacggtggaaaattacgccaccgcccgt
tcatccgacagctacccgtcgttttccccgatgctggttgaatggctgaaagaggcctgg
ctgctggcctccgcggaaatgcagcagaccgaactgcccggcggcgtgctgctgctcgcc
ctgctgcattcgccgttgcgctacctgccgcccgccgccgcccggttgctgaccgccatc
aaccgcgacctgctccggcaggattttgccgggtggacgaaggagtccgccgaatcggtg
atcctgaatgcggacggacagaccgccagcgccatagccgataccggcgacaccctgctg
gcccgctatgccaaaaacatgaccgacgatgcccggcaggggcggcttgatccggtgctg
tgccgcgataacgaaattgacctgatgatcgatatcctctgccgccgccgtaaaaataat
ccggtggtggtgggcgaagcgggcgtgggcaaaagcgcgctgattgaagggctggcgctg
cgcattattgccggtcaggtgccggacaaactgcgcgataccgatattatgacgctggat
ctcggcgcattacaggcgggcgcgtcggtgaaaggtgaatttgagaagcgctttaagggg
ctgatggcggaagtcattcagtcgccgaaacccgtcatcctgtttatcgacgaagcccac
acgctgattggcgcgggcaaccagcagggcgggctggatatctccaacctgctcaaaccg
gcactggcgcgcggcgagctgaaaaccatcgccgccaccacctggagcgaatacaaaaaa
tacttcgagaaagactccggcctgtcggcggtgtatgagcagtcccacggcgtgctgatt
gacgatgaagccttacaggccgctgcgacgttgagcgagcgctacctgtcaggccgccag
ttgccggataaggccattgatgtgctggataccgcctgcgcccgcgtggcgattaacctc
tcctcgccgccgagacaaatctcggcgctgaccaccctgcgccagcagtgtgaagcggaa
atccgccagcttgagcgtgagatccgtattggcctgcggtcggacacctcacggctaaac
gaggttctggcgcagtatgacgaaacgctgagcgaactggatgcgctggaggccgcgtgg
cgccagcagcagacgctggtgcaggagattatcgcgctgcgtaaggggctgctggacgaa
acggacgctaccggcaacgacgaaaccgcaacgcctgaaacagaggcggtgggcagtgac
gatgaatccgtcacagcgccgccggaagcggaaccggaaatttcgccagccgcccgcctc
gcgcagctcaccgccgaactggacgccctgcaccacacgcagctgctggtctccccacac
gtcgataaaaaacagatagccagcgtgattgccgaatggaccggcgtgccgcttaaccgc
ctgtcacaaaacgaaatgtcggtcatcaccgacctgccgcagtggctgggcgacaccatt
aaaggccaggcgctggcgattaagcacctgcacaaacacctgctgaccgcccgcgccgat
ctgcgccgtccgggacgcccgctcggcgcgttcctgctggccggtcccagcggtgtcggc
aaaaccgaaaccgtgctgcaactggccgaactgctctacggcggtcgccagtacctgacc
accatcaatatgtcggagtttcaggagaaacacaccgtttcacgcctgattggttcgccg
ccgggctatgtcggctacggcgagggcggcgtgctgaccgaagcgattcgtcagaaaccg
tactccgtggtgctgctcgacgaggtggagaaagcccacccggacgtgctcaacctgttc
taccaggcgttcgacaagggcgagatggccgatggcgaagggcgtcttatcgactgtaaa
aatgtggtgttcttcctcacctccaacctcggctatcaggtgattgtcgaacatgccgac
aacccggaagccatgcaggaagcgctgtacccggtactggcggacttctttaaaccggcg
ctgctggcgcggctggacaacgtactgcgcgcccgcttcggcgcggaggtggtgattgag
ccggaggtgaccgacgaaatcatgcagcgcgtcacccgcgccgaaaacggcgcgcggatg
ctggagtcggtcatcgacggcgagatgctgccgccgctctccctgctgctgttgcagaaa
atggcggcgaatatcgccattgcccgtatcacgctgggcgtggcaaacggcgcgtttacc
gcggatgtggaggatgtgccggatgaggatactcagcccgtagcggaagcagaggacgaa
gccgttctatga

DBGET integrated database retrieval system