KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1914
Entry
SPUL_1914         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11909  type VI secretion system protein VasI
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1914
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   SPUL_1914
SSDB
Motif
Pfam: VasI
Other DBs
NCBI-ProteinID: AET54243
Position
1903059..1903796
AA seq 245 aa
MSRMQTLLIMALLPGLLPGAVQAETAAKQTAAALPGIVVPGVPETDAQATLSAMTACRRE
PAALERLDCYDKILTPEQPGFASALVKAKYEGEAWKRAFAQEKQRPDNSTALIMTQSGGE
RPTVIITTPAIGNVPPRPVLMFSCVDNITRMQVALTHAMTPDSIDVTLTADTRQIRSRWF
IRENGTLLESSRGLSGIDEIKQLFGAKTLTIDTGTDSAAGKLTFNIDGLAKTIAPLREAC
HWAGE
NT seq 738 nt   +upstreamnt  +downstreamnt
atgagcagaatgcagacgctcctgatcatggcgctactgccgggattactccccggcgca
gtacaggcggaaaccgcggccaaacagacggctgccgcgctgccgggaattgtggtgccg
ggcgtcccggaaacagacgcacaggcgacactcagcgccatgacggcctgtcgccgggag
cctgcggcgctggagcgtctggactgctacgacaaaatcctcaccccggagcagcccggt
tttgccagcgcgctggtgaaggcaaaatacgaaggggaagcctggaaacgcgccttcgcc
caggaaaaacagcgcccggacaactccaccgcgctgataatgacgcagagcggcggcgag
cggccaacggtgattatcaccacgcccgccatcggcaacgtaccgccgcgcccggtgctg
atgttcagctgcgtggacaacatcacccggatgcaggtggcgctgacccacgccatgacg
ccggacagcatcgacgtgacgctgaccgccgatacccgacagattcggtcgcgctggttt
atccgcgaaaacggcaccctgctggagtccagccggggcttatccggcatcgacgaaata
aaacaacttttcggcgcaaaaacgctgaccattgataccggcaccgacagcgcagccgga
aaactgacgtttaacattgatggactggcaaaaaccatcgcgccgctgcgtgaagcctgt
cactgggcgggagaataa

DBGET integrated database retrieval system