KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1915
Entry
SPUL_1915         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1915
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1915
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N FAM86
Other DBs
NCBI-ProteinID: AET54244
Position
1903915..1905210
AA seq 431 aa
MLKLGSLAHSQLDIPEIQRRGLVILASESKDFRLLAHLLRTLQHAGDPLLALRLLALYVE
HYWTVAAPQNAAHKQRFATQVLKRFETGVESFAETARTAQRDSLLAELAKLAQRWQEQNI
PALAQAVDDLSSQYRRAFRGAAPVPPAAGPSTPPAPVSATPSAPVSPSAPAATTAPPVDI
DSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQAITSVPQAESDGRTPLAAVPA
DMTADYQARLNNADLALWQQVEKSLLLAPYWLDGHYLSAQAAQRLGYTSAAEAIRDEVVR
FLARLPQLATLLFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVRQCFSEQGLEA
TLRYLETLPEGDPRDRFHRQYLGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLL
EQLENKLTAEQ
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgcttaaactcggctcgctggcgcacagtcagctggatatcccggaaattcagcgccgg
gggctggtgattctggcctcggaaagcaaggattttcgcctgctggcccatctgctgcgc
accctgcaacatgccggcgatccgctgctggcgctgcgtctgctggcgctgtacgtggag
cattactggacggtggcggcaccacaaaatgcggcacataaacagcgtttcgccacccag
gtgctgaaacgctttgaaaccggcgtggagagtttcgcagagacagcccgtaccgcgcag
cgcgacagcctgctggctgaactggcgaaactggcgcagcgctggcaggagcagaatatc
ccggcgctggcacaggccgtcgatgacctctcgtcgcagtatcgccgggcatttcgcggg
gccgccccggtgccgccagcggctggcccgtccacgcctccggctccggtttcggccacg
ccgtccgccccggtatccccgtctgcgcctgcggcgacgacggcgccaccggtggatatc
gacagccatgacgacaaagcctggcgcgacacgctgctgaaagtggccgccattctctgt
gagcgccagccggattcaccgcagggctaccgcctgcgccgccatgcgttatggcaggcc
attacatccgtcccccaggccgaaagcgacgggcgcacaccgctggcggcggtgcctgcc
gacatgaccgccgattaccaggcgcggctgaacaacgccgatctggcgctctggcaacag
gtggaaaaaagcctgctgctggccccgtactggctcgatggtcattacctttcagcgcag
gccgcacaacgcctgggctacaccagcgcggcagaagccatccgggatgaggtggttcgc
tttctcgcccgcctgccgcaacttgccaccctgctgtttaatgaccgcacaccgtttatc
agcgaacagacaaaacagtggctggcggcgtctccgggcagtcagacagccccgatggtg
cggaccagtgaagacaccgaggccgtccgccagtgtttcagcgagcaggggctggaggcc
acgctgcgatacctggaaaccctgccggaaggcgatccgcgcgatcggttccaccggcag
tatcttggcgcgcaactgttagaagaagccgggatggcgcaactggcacagcaacagtac
cggatgttgtttaaagcagggctgcgcatgacgctggctgaatgggagccgtccctgctg
gaacaactggaaaacaaactcacggcagaacagtaa

DBGET integrated database retrieval system