KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1917
Entry
SPUL_1917         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_1917
Secretion system [BR:sel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUL_1917
SSDB
Motif
Pfam: VasL ImpA_N BCCT
Other DBs
NCBI-ProteinID: AET54246
Position
1908761..1910155
AA seq 464 aa
MSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKLVESLALAIFKAHGVDL
HTATYYTLARTRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNSRTGNIL
RQQLSFSGADLPLLYRTERALQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSS
VDIPPQTTVRTLIYAPESTQPLTAENLPPLPELPEMKVEVHHGAVEDPEPVARATSGRTI
KGFMAGVVCAAAVAAALWWWQVYPMQQQLAQVRDTAQGAAMLWLASPELDSYGQRLQQLP
DASPLQLLEAGMQMMHTADSRWPESLQQQQATAQWNEILKTRAQSSPQMRGWQQARQNLR
DFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQYQDARAQGRNAEVLEK
QINERLDGVLSRWLLLKNNVVPETATKAPPPKIIVKSRRLTWPI
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagtcaggacgcactcacgcacattattgttaccggccaggatccgcgcggcctgccg
gagttcagcgccctgcgggaagagatcaacaaatcgtctcacccgtcgcagccggagctg
aactggaaactggtggaatcgctggcgctggccatttttaaagcccatggcgtggatctg
cacacggccacttattacaccctggcgcgcacccgcacgcacggcctggccggattttgc
gaaggagtggagctactggcggccatgataagccacgactgggacaaattctggccgcag
gatgagtcagcccgcaccgggatgcttgactggcttaattcgcgcaccggcaatattctg
cgccagcagctgtccttctccggcgcggacctgccgttgctgtaccgcaccgaacgggcg
ttacagttgatttgcgacaaactccagcaggtggaactgaaacgccagccgcatgtggag
aacctgctttattttgtgcagaacacacgtaagcggcttgagccgccgccgaaaagcagc
gtggacattccgccgcagaccaccgtcagaacgttgatctacgccccggagagcacgcag
cccctcacggcggaaaaccttccgcccctgcctgagttgccggaaatgaaggtggaagtc
caccacggcgcggtggaggatccagagcctgtcgccagggccacgtcaggccggactata
aaaggctttatggccggtgtcgtctgcgctgcggctgtcgcagccgcactctggtggtgg
caggtgtacccgatgcaacagcaactggcgcaggtaagggacacggcgcagggcgcggca
atgctctggctggcctcgcctgaactggacagctacgggcagcggttacaacagcttccc
gacgcctcgccgctgcaactgctggaggcggggatgcagatgatgcataccgcagacagc
cgctggccggagagtctgcaacagcagcaggcaacagcgcagtggaatgaaatcctgaaa
acccgcgcgcaaagcagcccacaaatgcgcggctggcagcaggcgcgccagaatctgcgt
gactttgctgacctgatgatgcagcgggaaacggagaagcagggctttaccctctcctat
attaaaacggtgacctggcaggcggaacgcctgctgaaccaggaaacgccgctggagtcc
ctgctgacgcagtaccaagatgcccgcgctcagggacggaatgcggaggtgctggaaaaa
caaattaatgaacggctggatggggtgttaagccgctggctgttgctgaaaaacaatgta
gtgccggaaacggcaactaaagccccccccccgaaaataatagttaaatcaaggagatta
acatggccaatttaa

DBGET integrated database retrieval system