KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1918
Entry
SPUL_1918         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K06887  uncharacterized protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPUL_1918
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AET54247
Position
1910143..1910622
AA seq 159 aa
MANLIYLTLNGEKQGLISAGCCSLDSIGNKAQLLHLDHIMVYELTHGLSRDQNVNHHSVT
IKKPVDKSSPLLGKAINDNEILTCTFDFYRTNRFGINEKYYKLELKNARISDINFSIAHV
VIDSEAQPQESISFIYESINWEHCIAGTSAFSLWDERVF
NT seq 480 nt   +upstreamnt  +downstreamnt
atggccaatttaatttatttaacactgaacggtgaaaagcaaggattgatttcagcaggt
tgttgttcccttgactctatcggtaataaagcacagttactgcaccttgatcatattatg
gtatatgaactgacacatgggttaagtcgggatcaaaatgtcaatcatcattcagttacg
ataaaaaaacctgtcgataaatcatctcctttactgggaaaagcaattaacgataatgaa
atattgacctgcacttttgatttttatcgaacaaatcgatttggtattaatgaaaaatat
tacaaactggaattaaaaaacgcccgaattagtgatattaatttctcgattgcgcatgta
gtcattgacagtgaagcacaacctcaggaaagtatttcttttatatatgaatccataaac
tgggaacactgtattgccgggaccagtgcattcagtttatgggatgagagggtgttttag

DBGET integrated database retrieval system