KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1919
Entry
SPUL_1919         CDS       T01740                                 

Definition
(GenBank) putative DNA-binding protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: LysM
Other DBs
NCBI-ProteinID: AET54248
Position
1910655..1911527
AA seq 290 aa
MVNRTASAHKGIPTTENPRERPQVNTRTTGKGSGHPPKKLSPLDEWKAGREKAIGNPDWY
IYDNTIRKLVSEINRHLSTSKNIEKYKPLDWKLIKAMIWTETGAAVAEWKTRPIQIGNTG
DEGIKEVVIPARPRKYNIIIPKTWNTYLINKTDLIRSNPEYNIRAGIALLMIKMSETEKD
KIVYDNENEDTYEVVEGDRGYSSIAKKIGTTQSVLTKLNGVKVIHPGDKLKYKKAHLEQY
IPGWLLFTPENIQKQYNIDPTKAQPGHRGDHTYADKIRFTYALIVADESK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtaaatcgcacagcatcggcacacaaaggcatcccaacaacagaaaatccgagggaa
agaccccaggtaaatacccggacaacagggaaagggtctggacaccctcccaaaaaactc
agtcctcttgatgagtggaaggctggccgggaaaaagcgattggcaatcctgactggtat
atttatgataatacaatcaggaaacttgtatctgagattaatcggcatttatcaacatct
aaaaacatcgaaaaatataagccgctggactggaaattgattaaggcaatgatatggact
gaaacaggtgcggcggtagcggagtggaaaacgagaccaatacagataggaaacacagga
gatgaggggatcaaagaagtggttattcctgctcgccctagaaagtacaacatcataatt
ccgaaaacatggaacacatatttaatcaataagacagatcttataaggagcaatccagaa
tataacatccgggcgggcattgctcttttaatgataaaaatgtcagaaacagaaaaagat
aaaattgtttatgacaatgaaaatgaagatacctatgaagttgttgagggtgatcgtggt
tatagctccatagccaagaaaataggtacaacacagagtgttcttactaaactgaatggc
gttaaagtcattcaccccggagataaacttaagtataagaaagcgcatctggaacagtat
ataccaggatggcttttatttacacctgaaaacattcaaaaacaatataatatagaccca
acaaaagcacaacctggtcatagaggggatcacacctatgcggataaaatcagattcaca
tacgctctcattgtcgcagatgagagtaaataa

DBGET integrated database retrieval system