KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1920
Entry
SPUL_1920         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54249
Position
1911995..1912366
AA seq 123 aa
MRKKFLIIINFIMAFFYCNYLFAENVNHIVIYDMPQDLRDFFETADSCEGWIRDFDVRQE
KLTYQFVEDSIKRDCSNIENKLLSMKNKYKNNKDYSARLTVYDDTIIIYDEYKKTQIKNE
SNE
NT seq 372 nt   +upstreamnt  +downstreamnt
atgcgcaagaagttccttattataattaatttcattatggcatttttttactgtaactat
ttatttgcagaaaatgttaaccatatcgttatttatgatatgccgcaagacttacgggat
ttttttgaaaccgctgattcctgtgaaggatggataagggattttgatgttcgtcaagaa
aaattgacttatcagtttgtagaggattcgattaaaagagactgctcaaacattgaaaat
aaattactctcgatgaaaaacaaatacaagaataataaagattattcagcaagactaacg
gtctatgatgataccatcataatatatgacgagtataaaaagacgcaaataaaaaatgaa
agtaatgagtga

DBGET integrated database retrieval system