KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1921
Entry
SPUL_1921         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54250
Position
complement(1913385..1913510)
AA seq 41 aa
MLGYAPFHPTSGNDGFGSWKSEAHFGIKVCQSSDTFVQALF
NT seq 126 nt   +upstreamnt  +downstreamnt
atgttgggttacgcgccgttccacccaacctccgggaacgatggttttggcagttggaaa
agcgaagcgcatttcggcatcaaggtttgtcagtcgtctgatactttcgtacaggctctt
ttttga

DBGET integrated database retrieval system