KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1923
Entry
SPUL_1923         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: YCII
Other DBs
NCBI-ProteinID: AET54252
Position
1913813..1914091
AA seq 92 aa
MVVLTYVKPLHEIDAQIPAHVEWLKKGYADGLFLASGRKIPRTGGVILANYDDADVLQNY
LAQDPFRLSGVAKVDLIPFEPTMMVTELKAVL
NT seq 279 nt   +upstreamnt  +downstreamnt
gtggttgtcttaacctacgtaaaaccattgcatgaaattgatgcgcaaatccctgcacat
gtggaatggctaaaaaaaggttatgccgatggactttttctggcttccgggcgaaaaatt
ccgcgcacaggaggcgtaatacttgcaaactatgatgacgcggatgtactgcaaaactat
ctggcacaagatccttttcgcttgtctggcgtagctaaagtcgatttgattccttttgaa
cccacaatgatggtcacggaattaaaagcggtcttataa

DBGET integrated database retrieval system