KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1924
Entry
SPUL_1924         CDS       T01740                                 

Definition
(GenBank) putative oxidoreductase
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: GFO_IDH_MocA_C GFO_IDH_MocA Semialdhyde_dh F420_oxidored Sacchrp_dh_NADP Pyr_redox 2-Hacid_dh_C NmrA
Other DBs
NCBI-ProteinID: AET54253
Position
complement(1914258..1915361)
AA seq 367 aa
MTKYGVVGTGYFGAELARFMSKVEGAKITAIYDPVNAAPIAKELNCVATATMEALCSHPD
VDCVIIASPNYLHKAPVIAAAKAGKHVFCEKPIALNYQDCKDMVDACKEAGVTFMAGHVM
NFFHGVRHAKALIKAGEIGEVTQVHTKRNGFEDVQDEISWKKIRAKSGGHLYHHIHELDC
TLFIMDETPSLVSMAAGNVAHKGEKFGDEDDVVLITLEFESGRFATLQWGSSFHYPEHYV
LIEGTTGAILIDMQNTAGYLIKAGKKTHFLVHESQAEDDDRRNGNISSEMDGAIAYGKPG
KRTPMWLSSIMKLEMQYLHDVINGLEPSEEFAKLLTGEAATNAIATADAATLSSNEGRKV
KLTEILG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgacgaaatacggtgttgtaggtacaggttattttggcgctgaactggcgcgatttatg
tctaaggttgaaggggcgaaaatcactgcgatttacgatccggtaaatgcggctccgata
gcgaaagagttgaactgtgtcgccactgcaacgatggaggcgctttgttcccatcctgat
gtggattgcgtaattattgcttcaccaaattacttacataaagcgccagtcattgcggcg
gctaaagcgggtaaacacgtgttttgtgaaaaacctatcgccttaaattaccaggattgt
aaggatatggttgatgcctgcaaagaagctggtgttacctttatggcgggtcacgttatg
aacttttttcacggggttcgccacgctaaagcgctcatcaaagctggtgaaattggtgaa
gttacacaagttcacactaaacgtaatggttttgaagacgtgcaggatgagatctcatgg
aagaagattcgcgcaaagtcaggtgggcatctgtaccatcacattcacgagctagattgt
acactgttcatcatggatgaaaccccatccctggtttcaatggcggcggggaatgttgcg
cacaaaggtgaaaaatttggtgatgaagatgatgttgtcctaatcacccttgagtttgaa
agcggtcgtttcgcgacacttcagtggggatcatcgttccactaccctgagcactatgta
ttaattgagggcacgacaggtgcaattctcattgatatgcaaaacacggctggttatcta
ataaaagcgggcaaaaaaacacactttcttgtgcatgaaagccaggcggaggatgatgat
cgtcgcaacggtaacatatccagcgagatggatggcgcaatcgcttatggtaaacccggt
aaacgtacgccgatgtggctctcatcaattatgaaactggagatgcagtacttgcatgat
gtgataaacggtctggagccaagcgaggagtttgctaaattgctaacgggagaagcggcg
acaaatgctattgctaccgctgatgctgcgacgctttcctcaaacgaggggcgcaaagtt
aaactcactgaaattcttggctaa

DBGET integrated database retrieval system