KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1925
Entry
SPUL_1925         CDS       T01740                                 

Definition
(GenBank) putative transporter
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Other DBs
NCBI-ProteinID: AET54254
Position
complement(1915375..1916655)
AA seq 426 aa
MIAKFFPWYSEITRPQKNALFSAWLGYVFDGFDFMLIFYIMYLIKADLGLTDMEGAFLAT
AAFIGRPFGGALFGLLADKFGRKPLMMWSIVAYSVGTGLSGLASGVIMLTLSRFIVGMGM
AGEYACASTYAVESWPKHLKSKASAFLVSGFGIGNIIAAYFMPSFAEAYGWRAAFFVGLL
PVLLVIYIRARAPESKEWEEAKLSGPGKHSQSAWSVFSLSMKGLFNRAQFPLTLCVFIVL
FSIFGANWPIFGLLPTYLAGEGFDTGVVSNLMTAAAFGTVLGNIVWGLCADRIGLKKTFS
IGLLMSFLFIFPLFRIPQDNYLLLGACLFGLMATNVGVGGLVPKFLYDYFPLEVRGLGTG
LIYNLAATSGTFNSMAATWLGITMGLGAALTFIVAFWTATILLIIGLSIPDRLKARRESF
QSTKEF
NT seq 1281 nt   +upstreamnt  +downstreamnt
gtgatagcaaaattcttcccgtggtatagcgagataacacgtccacaaaaaaatgcttta
ttttcagcatggctgggttacgtttttgatggcttcgactttatgctgattttctacatt
atgtatctgatcaaggctgacttaggattgacagatatggagggcgcattccttgccaca
gcggcctttattgggcgaccatttggcggggcgctatttggtctgctggcagacaaattt
ggccgtaagccgttaatgatgtggtcgatagttgcctattctgtaggtacagggttaagt
ggcctggcttccggtgtaattatgctgacgcttagtcgcttcattgtcggtatggggatg
gcgggggagtatgcttgcgcttctacttatgccgtggaaagttggccaaagcatttaaaa
tctaaagcgagcgcatttctggtttcaggtttcggtattggtaacatcatagcagcctat
tttatgccgtcatttgccgaagcgtatggttggcgtgctgctttttttgtcggtttgcta
cccgttcttttagtaatctacatccgggccagggctcctgaatctaaagagtgggaagaa
gctaaactcagtggtcccggaaagcattcacaaagtgcctggtcagttttctctttgtca
atgaaagggctatttaatcgagctcaatttccactgacattatgtgtatttattgttctg
ttctctattttcggcgcaaactggccgatctttggtctactgcctacatatttggcggga
gagggctttgatacgggcgtggtctctaatttaatgacggcggcggcattcggcactgta
ttgggaaatatcgtttggggtctgtgcgcagatagaattggtttgaagaaaacgttcagc
attggtcttctcatgtcctttttattcattttcccgttattcagaattccgcaagataat
tatttactgctgggcgcatgtttattcggtttaatggcgactaacgtaggtgttggcggg
ttggttcccaaatttctctacgactactttcctcttgaggttcgtggtttgggtaccggg
ctgatttataatcttgctgcgacatcaggcacattcaattcaatggcggcgacctggctt
ggaataacaatggggctaggagctgcgctaacgttcattgttgctttctggaccgcaaca
attctactcattattggcctatccattccggatagactaaaagcacgtcgtgaaagtttt
caatcaacaaaagaattttaa

DBGET integrated database retrieval system