KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1928
Entry
SPUL_1928         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K01788  N-acylglucosamine-6-phosphate 2-epimerase [EC:5.1.3.9]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00520  Amino sugar and nucleotide sugar metabolism
sel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPUL_1928
Enzymes [BR:sel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.9  N-acylglucosamine-6-phosphate 2-epimerase
     SPUL_1928
SSDB
Motif
Pfam: NanE CHASE2
Other DBs
NCBI-ProteinID: AET54257
Structure
PDB: 
3Q58

Position
1919420..1920016
AA seq 198 aa
MDKPEIVAAMAQAAASAGAVAVRIEGIENLRAVRPHLSVPIIGIIKRDLTGSPVRITPYL
QDVDALAQAGADIIAFDASFRSRPVDIDSLLTRIRLHGLLAMADCSTVNEGISCHQKGIE
FIGTTLSGYTGPITPVEPDLAMVTQLSHAGCRVIAEGRYNTPALAANAIEHGAWAVTVGS
AITRIEHICQWFSHAVKR
NT seq 597 nt   +upstreamnt  +downstreamnt
atggataaacctgaaattgtggctgcaatggcacaggcagcggcttcggcgggtgcggtc
gctgtgcgcattgaaggcattgagaatctgcgggctgttcgtccccatctttctgttcct
attattgggataattaaacgtgaccttacagggtcgccagtccgtatcactccctattta
caggatgttgacgccctggcgcaggcaggtgccgatattatcgcttttgatgcctcattc
cgctctcgcccggttgatattgatagtttactgacacgtattcgcctgcatggattactg
gcgatggcagactgttcaaccgtgaatgaaggcataagttgccatcagaaaggaatcgaa
ttcattggtacaacactgtctggctataccggccccatcacgccggttgagccagatttg
gcaatggtgacacaactgagccatgcaggttgtcgtgttattgccgaggggcgctataac
acgcctgcactggcggccaatgctattgagcatggtgcctgggcagttaccgttggttcc
gctatcacccgtatcgagcatatctgtcagtggttcagtcacgcagtaaaacgctga

DBGET integrated database retrieval system