KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1929
Entry
SPUL_1929         CDS       T01740                                 

Definition
(GenBank) putative sodium/glucose cotransporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SPUL_1929
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-ProteinID: AET54258
Position
1920353..1921849
AA seq 498 aa
MITHSFGIVNYLVLFGYLLAMMLVGVYFSRRQKTADDYFRGGGRVPGWAAGVSVFATTLS
SITFMSIPAKAFTSDWTFIIGQYLAIAILPLVFYFYIPFFRKLKVTSAYEYLEARFDVRC
RLFASMSFMLFHIGRIAIITFLTVLALRPFIAIDPVILVLLISVMCIIYTWMGGIEGVIW
TDVIQGLLLSGSAILIFIVICLKVQGGIGEIFTVTQQADKFFPATQFHWSWTESTVPVLM
IGFLFANIQQFTASQDVVQRYIVTDSIEETKKTLLTNAKLVAVIPVFFFAIGSALFVYYQ
QHPQLLPAGFNTGGILPLFVVTEMPVGIAGLIIAAIFAAAQSSISSSLNSISSCFNSDIY
QRLSHKKRTPENRMKIAKLVILVAGLISSAASVWLVMADESEIWDAFNSLIGLMGGPMTG
LFMLGIFFKRANAGSAVLGIIISVITVLGARYATDLNFFFYGVIGSLSVVISGVIFAPLF
APAPPLTLDEKPEPKVTL
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgattacacattctttcggcatcgttaactatcttgtattatttggctacctcctggcc
atgatgttagtcggtgtctatttttccagacggcaaaaaacagcagacgattattttcgc
ggtggtggccgggttcctggttgggcggctggggtcagtgtatttgctactacgttaagc
tcaattacatttatgtcaattcctgccaaagcgtttacttccgactggacgtttatcatt
ggtcagtatctggctatcgcaattttaccgctggttttttatttctatattccgtttttt
cggaaattgaaagtcacatcagcctatgaatatctcgaagcacggttcgatgtgcgctgc
cgtctattcgccagcatgtcatttatgttgtttcatatcggacgtatcgccattatcact
ttcctcaccgtgctggccttgcgccccttcatcgctatagacccggtgattttggtactg
ttgattagcgtgatgtgtatcatttatacttggatgggtggaattgaaggagtaatatgg
actgatgttattcaaggcctcttactttctggcagcgcgatactgatttttatagtgata
tgtctcaaagtccagggcggcattggtgaaatttttacggtgacgcagcaggcggataaa
ttctttccggctacgcagttccactggagctggacggaaagcacagtacctgtattgatg
attggttttctgtttgccaatattcagcaatttactgccagtcaggatgtggtccaacgc
tatatcgtgactgactccatagaggaaacgaagaaaacattacttacaaatgccaaactg
gttgctgtgatccctgttttcttttttgctatcggctcggcattgtttgtctactatcag
caacatccacaattattaccggcgggattcaacactggcggcattttgcccttattcgtg
gtcaccgaaatgccagtcggcattgcagggttgataatcgccgctattttcgctgctgcg
cagtccagtatctccagcagcttaaacagcatttccagttgttttaattccgatatctat
cagcgtttgagtcataaaaaaagaacgcctgaaaaccgtatgaaaatagctaagttagtt
attctggtcgcgggcctgataagtagcgcggcctcagtatggctggtcatggccgatgaa
tcagaaatctgggatgcatttaatagtctgataggtctgatgggagggccaatgaccggt
ctgttcatgctgggcattttctttaaacgagcaaatgccgggagtgcggttttaggaatt
attatcagcgtcattaccgtgctgggcgcacgctatgccactgaccttaacttcttcttt
tatggggtcattggctcgctaagcgtggtgatcagcggcgttattttcgccccgttattt
gccccggcaccgccattgacgctggatgaaaaacctgagccaaaggtgacattatga

DBGET integrated database retrieval system