KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1930
Entry
SPUL_1930         CDS       T01740                                 

Definition
(GenBank) putative transcriptional regulator
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: HTH_6 SIS SIS_2
Other DBs
NCBI-ProteinID: AET54259
Position
1922135..1923016
AA seq 293 aa
MEPQPPRLKPGKILDTLGAMQKSLTRASQRIAQYILAFPRQVTQSSIADLSRDTQAGEAT
VIRFCRTLGYKGFQDFKMDLAIELATTESDDSSPLLDAEVSESDDAHAIGLKLQNTISNV
LSETLNLLDMQQVLGVVDALRHCHSVYIFGVGSSGITALDMKHKLMRIGLRGDAVSNNHF
MYMQATLLKAGDVAMGVSHSGTSPETVHSLRLARQAGATTVAITHNLGSPLCEEADFCLI
NGNRQGMLQGDSIGTKAAQLFVFDLLYTLLVQSSPEQARESKLRTMNALDMTK
NT seq 882 nt   +upstreamnt  +downstreamnt
atggagcctcaacccccacgtcttaaacccggaaaaatccttgacactctgggtgctatg
caaaaaagcctgacacgtgcctcccagcgtattgcgcaatatattttagccttccccaga
caggtgacacagtcatctattgccgatttgtcgcgcgacacacaggccggagaagccacg
gttattcgcttttgtcgcaccctgggctataaaggttttcaggattttaaaatggacctg
gccattgaacttgccactaccgagtctgatgacagtagtcctctactggatgccgaagtt
agcgaatccgacgatgcccacgccattggtttaaaattgcagaacaccattagtaatgta
ttgtctgaaacgctaaatctgcttgatatgcaacaggttctcggtgtcgtggacgcccta
cgtcactgtcactcagtttatatctttggtgtgggctcatcggggatcacggcgctggat
atgaaacacaagctaatgcgtattggtttacggggcgatgcggtaagcaataaccatttt
atgtacatgcaggctacgctattaaaagcaggcgatgtcgcgatgggtgtcagtcactcg
ggcacatcgccagaaacagtgcattcactccgattggcccgacaggctggcgccaccaca
gtcgccattacccataatctgggttctccattatgtgaagaggccgatttttgcctgatc
aatggtaatcggcaaggaatgttgcagggtgactcgatcggtacgaaagccgcgcagctt
ttcgtctttgacctgctctatacccttcttgtacagtcctcgccggaacaggcccgagaa
agcaaattacggacaatgaatgccctggacatgacaaaataa

DBGET integrated database retrieval system