KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1931
Entry
SPUL_1931         CDS       T01740                                 

Gene name
phoH
Definition
(GenBank) PhoH protein (phosphate starvation-inducible protein PsiH)
  KO
K06217  phosphate starvation-inducible protein PhoH and related proteins
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    SPUL_1931 (phoH)
SSDB
Motif
Pfam: PhoH AAA_30 AAA_22 AAA_19 IstB_IS21 DEAD ResIII DUF2075 DEAD_2
Other DBs
NCBI-ProteinID: AET54260
Position
complement(1923122..1923910)
AA seq 262 aa
MGRQKAVIKARREAKRVLRRDSRSHKQREEESVTSLVQMGGVEAIGMARDSRDTSPVKAR
NEAQAHYLNAIDSKQLIFATGEAGCGKTWISAAKAAEALIHKDVERIIVTRPVLQADEDL
GFLPGDIAEKFAPYFRPVYDVLLKRLGTSFMQYCLRPEIGKVEIAPFAYMRGRTFENAVV
ILDEAQNVTAAQMKMFLTRLGENVTVIVNGDITQCDLPRGVRSGLSDALERFEEDEMVGI
VHFNKDDCVRSALCQRTLHAYS
NT seq 789 nt   +upstreamnt  +downstreamnt
atgggaagacaaaaagcagtgatcaaagctcgtcgtgaagcaaagcgtgtgttgagacga
gattcgcgtagtcataagcaacgtgaagaagaatcggtcacgtcactggtacagatgggc
ggagtagaagccattggcatggcgcgcgatagtcgcgatacctcgcctgttaaggcgcga
aatgaagcacaggcgcattatctgaacgctatcgacagtaaacagcttatttttgcgacc
ggcgaagccggctgtggaaaaacatggatcagtgcggcaaaggcggcagaagcattgatt
cataaggacgtcgagaggatcattgtgacgcgtccggtattgcaggctgatgaagatctt
ggttttttgcccggtgatatcgctgaaaaatttgcgccttattttcgtcccgtctacgat
gtcctgcttaaacggttgggcacgtcctttatgcaatattgtttgcgcccggaaatcggt
aaggtagaaattgccccgttcgcctatatgcgtgggcgtacttttgaaaatgcggtcgtg
atcctcgacgaggcgcaaaatgtgactgcggcgcaaatgaaaatgtttttgacgcgacta
ggcgaaaatgtcacggtcattgtcaatggcgatattacgcaatgcgacctgccgcgcggc
gtgcgttccggattgagcgatgcgttggaacgctttgaagaagatgaaatggtagggatt
gtgcatttcaacaaagacgactgcgtgcgctcggcgctttgtcagcgaacgctccacgca
tacagctaa

DBGET integrated database retrieval system