KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1932
Entry
SPUL_1932         CDS       T01740                                 

Gene name
putP
Definition
(GenBank) sodium/proline symporter (proline permease)
  KO
K11928  sodium/proline symporter
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_1932 (putP)
Transporters [BR:sel02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPUL_1932 (putP)
SSDB
Motif
Pfam: SSF DUF4748
Other DBs
NCBI-ProteinID: AET54261
Position
complement(1924803..1926311)
AA seq 502 aa
MAISTPMLVTFCVYIFGMILIGFIAWRSTKNFDDYILGGRSLGPFVTALSAGASDMSGWL
LMGLPGAIFLSGISESWIAIGLTLGAWINWKLVAGRLRVHTEFNNNALTLPDYFTGRFED
KSRVLRIISALVILLFFTIYCASGIVAGARLFESTFGMSYETALWAGAAATIIYTFIGGF
LAVSWTDTVQASLMIFALILTPVMVIVGVGGFSESLEVIKQKSIENVDMLKGLNFVAIIS
LMGWGLGYFGQPHILARFMAADSHHSIVHARRISMTWMILCLAGAVAVGFFGIAYFNNNP
ALAGAVNQNSERVFIELAQILFNPWIAGVLLSAILAAVMSTLSCQLLVCSSAITEDLYKA
FLRKSASQQELVWVGRVMVLVVALIAIALAANPDNRVLGLVSYAWAGFGAAFGPVVLFSV
MWSRMTRNGALAGMIIGAVTVIVWKQYGWLDLYEIIPGFIFGSLGIVIFSLLGKAPTAAM
QERFAKADAHYHSAPPSKLQAE
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggctattagcacaccgatgttggtgacattctgtgtctatatttttggcatgatattg
attgggtttatcgcctggcgctcaaccaaaaactttgatgactatattcttggcggtcgc
agcctggggccgtttgttacggctttatcagccggcgcgtcggatatgagcggctggctg
ttaatggggctgcctggcgctatctttctgtcggggatctctgaaagctggatcgccatt
ggcctgacgttaggcgcatggattaactggaagctggtggccgggcgcctgcgcgtgcat
accgaatttaacaataacgcgctcacgctaccggactattttaccggtcggtttgaagat
aagagccgagtcctgcgtattatttccgcgctggtcattctgctgtttttcactatctat
tgcgcatcaggtattgtcgctggggcacgactgttcgaaagcaccttcggtatgagctat
gaaaccgcactgtgggcgggggccgcggcaaccattatttatacctttatcggcgggttt
cttgccgttagctggacggataccgttcaggccagcctgatgatttttgcgttaatcctg
acgccggtgatggttattgtcggcgtaggcggttttagcgagtcgctggaggtgatcaag
caaaagagcatcgagaatgtcgacatgctcaaggggctgaattttgtcgctattatttct
ctgatgggctggggactgggttacttcggtcagccgcatatcctggcgcgctttatggcg
gcggattcccatcacagtattgttcatgcgcgtcgtatcagtatgacctggatgattctg
tgtctggcgggcgcggtggcggtgggcttctttggcattgcgtactttaacaataacccc
gcactggccggggcggtgaaccaaaactcagaacgcgtatttattgaactggcgcagatc
ctgtttaacccgtggattgccggtgttctgctgtctgctatcctggcggcggtgatgtcg
acgttgagctgtcagttgctggtatgctccagcgcgattacagaagatttatataaggct
tttctgcgtaaaagcgccagccagcaagagctggtatgggtagggcgagtgatggtgctg
gtggtagcgctgatcgccattgcgctggcggcgaaccccgataaccgtgtgctggggctg
gtgagctacgcctgggctggattcggcgcggcatttgggcctgttgtcctgttttctgtg
atgtggtcgcgtatgacacgtaacggcgcgctggcgggaatgattattggcgcggtgacg
gttatcgtctggaaacaatatggctggctggatctgtatgagattatccctggcttcatt
ttcggcagcctggggatcgtaatctttagcctgcttggcaaagcgccgacagcagcgatg
caggaacgctttgcaaaagcggacgcgcattatcattccgcgccgccgtcgaagctacag
gcggaataa

DBGET integrated database retrieval system