KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1933
Entry
SPUL_1933         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54262
Position
complement(1926541..1926672)
AA seq 43 aa
MLQLCATALNVTCVASLKMNKLLKKERGSLTGKTIWIYFLCGS
NT seq 132 nt   +upstreamnt  +downstreamnt
atgttgcaactttgtgcaaccgcgttaaatgtgacctgcgttgcaagcttaaaaatgaat
aaattgttaaaaaaagaaagagggagtctgacggggaaaaccatctggatttattttctc
tgcggtagttaa

DBGET integrated database retrieval system