KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1934
Entry
SPUL_1934         CDS       T01740                                 

Definition
(GenBank) proline dehydrogenase (proline oxidase)
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00250  Alanine, aspartate and glutamate metabolism
sel00330  Arginine and proline metabolism
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPUL_1934
   00330 Arginine and proline metabolism
    SPUL_1934
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sel03000]
    SPUL_1934
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     SPUL_1934
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     SPUL_1934
Transcription factors [BR:sel03000]
 Prokaryotic type
  Ribbon-helix-helix
   Other families
    SPUL_1934
SSDB
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Other DBs
NCBI-ProteinID: AET54263
Position
1926733..1930695
AA seq 1320 aa
MGTTTMGVKLDDATRERIKMAASRIDRTPHWLIKQAIFSYLDKLENSDTLPELPALFAGA
ANESEEPVAPQDEPHQPFLEFAEQILPQSVSRAAITAAWRRPETDAVSMLMEQARLSPPV
AEQTHKLAYQLAEKLRNQKSASGRAGMVQGLLQEFSLSSQEGVALMCLAEALLRIPDKAT
RDALIRDKISNGNWQSHIGRSPSLFVNAATWGLLFTGRLVSTHNEANLSRSLNRIIGKSG
EPLIRKGVDMAMRLMGEQFVTGETIAQALANARKLEEKGFRYSYDMLGEAALTAADAQAY
MVSYQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYDRVMEELYPRLKSLTLLA
RQYDIGLNIDAEEADRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYLVDL
ASRSRRRLMIRLVKGAYWDSEIKRAQMEGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLI
YPQFATHNAHTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIY
APVGTHETLLAYLVRRLLENGANTSFVNRIADATLPLDELVADPVEAVEKLAQQEGQAGI
PHPKIPLPRDLYGEGRINSAGLDLANEHRLASLSSALLSNAMQKWQAKPVLEQPVADGEM
TPVINPAEPKDIVGWGREATESEVEQALQNAVNQAPVWFATPPQERAAILQRAAVLMEDQ
MQQLIGLLVREAGKTFSNAITEVREAVDFLHYYAGQVRDDFDNETHRPLGPVVCISPWNF
PLAIFTGQIAAALAAGNSVLAKPAEQTSLIAAQGIAILLEAGVPPGVVQLLPGRGETVGA
QLTADARVRGVMFTGSTEVATLLQRNIATRLDAQGRPIPLIAETGGMNAMIVDSSALTEQ
VVVDVLASSFDSAGQRCSALRVLCLQDDIAEHTLKMLRGAMAECRMGNPGRLTTDIGPVI
DSEAKANIERHIQTMRAKGRPVFQAARENSDDAQEWQTGTFVMPTLIELENFAELEKEVF
GPVLHVVRYNRNQLAELIEQINASGYGLTLGVHTRIDETIAQVTGSAHVGNLYVNRNMVG
AVVGVQPFGGEGLSGTGPKAGGPLYLYRLLAHRPPNALNTTLTRQDARYPVDAQLKTTLL
APLTALTQWAADRPALQTLCRQFADLAQAGTQRLLPGPTGERNTWTLLPRERVLCLADDE
QDALTQLAAVLAVGSQALWSDDAFHRDLAKRLPAAVAARVQFAKAETLMAQPFDAVIFHG
DSDKLRTVCEAVAAREGAIVSVQGFARGESNILLERLYIERSLSVNTAAAGGNASLMTIG
NT seq 3963 nt   +upstreamnt  +downstreamnt
atgggaaccaccacgatgggggttaagctggacgacgccacgcgcgaacggatcaaaatg
gccgcgtcgcgtatcgatcgcacgccgcactggttaataaaacaggcaatctttagctat
ctggacaagctggaaaatagcgatacgctaccggagctacctgcgctgtttgccggcgcg
gcaaatgaaagcgaggagccggtcgcgccgcaggatgagccgcatcagccctttctggag
tttgccgaacagattcttccccaatccgtctctcgcgccgccatcaccgccgcctggcgc
cgcccggaaaccgatgcggtgtcaatgctaatggaacaggcgcgcctgtcgccgcctgtc
gctgagcagacgcataaactggcgtatcaactggcggagaaattgcgcaatcaaaaatcc
gccagcggtcgcgcgggtatggtgcaagggctgttgcaggagttttccctctcttcgcaa
gaaggcgttgcgctgatgtgtctggcggaagcgctgctgcgtattcccgacaaagctacg
cgcgatgcgttaattcgcgacaaaatcagtaatggcaactggcagtcgcatattggccgt
agcccgtcgctgtttgtaaacgccgccacttgggggctgctctttaccggccgactggtc
tcaacgcataacgaagccaatctttcgcgctcgctgaaccgcattatcggcaagagcggc
gaaccgttaatccgcaaaggcgtcgacatggcgatgcgtttaatgggcgagcagttcgtg
actggcgaaaccattgctcaggcgctggcgaatgcccgaaaactggaagagaaagggttc
cgctattcttacgatatgctgggcgaagccgcgttaaccgccgccgatgcgcaggcctat
atggtctcttaccagcaagcgattcatgccatcggcaaagcgtctaacggtcgcggtatt
tacgaagggccaggcatctcgattaagctgtccgccctgcatccacgctatagtcgcgcg
caatacgatcgggtaatggaggagctttatccgcgcctgaaatcactgacgctgctggcg
cgccagtatgatatcggtctcaatatcgacgccgaagaggcggatcgtctggagatctcg
ctcgatctgctggaaaaactctgcttcgaacccgaactggcgggctggaacggcattggc
tttgtgatccaggcttaccagaaacgctgcccgctggtcattgattatttagtcgatctg
gcctcccgtagccgccggcggctgatgattcgtctggtgaaaggcgcctactgggatagc
gaaatcaaacgcgcgcaaatggaagggctggagggctatccggtttatactcgcaaagtg
tataccgatgtctcttatctggcctgcgcgaaaaaactgctcgccgtccctaatctgatc
tacccgcagttcgcgacccataacgctcacacactggcggcgatttatcatctggccggg
caaaattactatccgggtcagtacgaattccagtgcctgcacggcatgggcgaaccgctg
tatgaacaggtcaccggtaaagtggcggacggaaaacttaaccgtccctgccgtatttac
gcgccggtgggaacacacgaaaccctgctggcctatctggtacgacgcctgctggaaaac
ggcgccaacacctcttttgtcaaccgtatcgccgatgccaccctaccgctcgatgaactg
gtggcggacccggtcgaggccgtggaaaaactggcgcagcaggaaggtcaggctggcata
ccgcatccgaaaattccgctgccgcgcgatctgtacggcgaaggtcggataaactccgcc
ggacttgatttagcgaatgaacatcgcctcgcctcgctttcttctgccctgttaagcaac
gccatgcagaaatggcaggccaaacctgtgctggaacaaccggtggccgacggtgagatg
acgccggttatcaacccggcggaaccgaaagatattgtcggctggggacgcgaagcgaca
gaaagcgaggttgaacaggcattgcaaaacgcggtcaatcaggcgccggtttggtttgcg
acgccgccgcaagaacgcgccgccattttgcagcgggcggcggtattaatggaagaccaa
atgcagcagttgattggcctgttggtgcgtgaagcggggaaaacgttcagcaacgccatt
accgaagtgcgcgaagcggtagacttcctccattattatgccggtcaagtgcgtgacgat
ttcgataacgaaacgcatcgcccgttagggccggtagtctgcatcagtccgtggaacttc
ccgctggccattttcaccggccaaatcgccgccgcgctggcggcaggtaacagcgttctg
gcgaaaccggcagagcagacatcgctgattgccgcccagggcattgccattttgctggaa
gcgggcgtaccgccgggcgtcgtgcaactgttgccgggacggggagaaaccgtcggcgcc
cagcttaccgccgatgcgcgtgtacgcggcgtgatgtttaccggttccacggaggtcgcg
acgttgttgcagcgcaacatcgccacgcgtcttgacgcccagggccgccctattccgttg
attgcggaaaccggcggtatgaacgctatgattgtcgactcttccgcgctcaccgagcag
gtggtcgtggatgtgctggcttcctctttcgacagcgccggacaacgctgttccgcgctc
cgcgtgctgtgtttgcaggacgatatcgccgaacatacgctgaaaatgttacgcggcgcg
atggcggagtgtcggatggggaatccaggccgtctgacgaccgatatcgggccggtgatc
gatagcgaggccaaagccaacattgaacgtcacatccagacgatgcgcgccaaaggccgc
ccggttttccaggccgcacgtgaaaacagcgatgatgcgcaggaatggcagaccggtacg
tttgttatgcccacgcttattgagctggaaaacttcgcagaactggaaaaagaggtcttc
gggcccgtgctgcacgtcgtgcgttataaccgtaaccaactggcggagcttatcgaacag
attaacgcttccggctacgggctaacgctgggcgtacatacccgtattgatgaaaccatt
gcgcaagtcaccggttccgcccatgtcggcaacctgtacgttaaccgtaatatggtgggc
gcggtcgtcggcgtccagccgtttggcggcgaaggcctgtccggcaccgggccaaaagcg
ggaggaccgctctatctctaccgcctgctggcacaccgcccgcccaatgcgctcaatacg
acgctgactcgtcaggatgcgcgttacccggtggatgcgcagcttaaaaccacgctactc
gcgccgttgaccgctctgacgcaatgggcggcggatcgcccggcgctacagacgctctgc
cgacaattcgccgatctggcgcaggccggcacgcagcgcctgctaccgggaccgaccggc
gagcgcaatacctggacgctgttgccgcgtgaacgggtattatgcctggctgatgacgaa
caggacgcgttgacgcagcttgccgccgttctcgccgtcggcagtcaggcgctatggtca
gacgacgccttccaccgcgatctggcgaaacgtctccccgccgccgttgcggcgcgtgtc
cagtttgcgaaagcggaaacgctgatggcgcagccgtttgacgcggtgattttccacggc
gactccgacaagctgcgaaccgtgtgcgaagccgtcgccgcccgcgaaggcgcgatagtg
tcggtacaggggttcgcccgcggcgaaagcaatatactgctggaacggctctatattgaa
cgttcgctgagcgtaaacactgccgccgctggcggtaatgccagcctgatgacaattggc
taa

DBGET integrated database retrieval system