KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1935
Entry
SPUL_1935         CDS       T01740                                 

Definition
(GenBank) putative secreted protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: LprI DUF3316 FIVAR DUF3715
Other DBs
NCBI-ProteinID: AET54264
Position
1930754..1931149
AA seq 131 aa
MKRIFLTCAALWFSSQALADECASSSTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP
QRELLQKAQMAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE
GDLSCPLPPAG
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaaacgaattttccttacctgcgcggcgttgtggttcagcagtcaggcgttggccgat
gagtgtgccagctccagtacgcagctggaaatgaatcgctgcgccgccgcgcaataccag
gcggcagataaaaagctgaacgaaacctatcaaagcgcgattaagcgtgcgcaaccgccg
cagcgcgagctgttgcaaaaagcgcagatggcatggattgcactgcgggacgccgattgc
gctctgattcgctcaggtacggagggcggcagcgtgcaacccatgatcgccagccagtgc
ctgaccgataaaacgaacgaacgcgaagcgtttttagcctcgctgctgcaatgtgaagag
ggtgatttgagctgcccactgccgccagccggttaa

DBGET integrated database retrieval system