KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1938
Entry
SPUL_1938         CDS       T01740                                 

Gene name
wraB
Definition
(GenBank) trp repressor binding protein
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00130  Ubiquinone and other terpenoid-quinone biosynthesis
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SPUL_1938 (wraB)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     SPUL_1938 (wraB)
SSDB
Motif
Pfam: FMN_red Flavodoxin_1 Flavodoxin_5 Flavodoxin_2
Other DBs
NCBI-ProteinID: AET54266
Position
1932117..1932713
AA seq 198 aa
MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPV
ATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFSSTGTGGGQ
EQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELS
IARYQGEYVAGLAVKLNG
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcaaagattctggtgctctattattccatgtacggacacattgaaaccatggcgcac
gcggtggcggaaggggcaaagaaagtcgacggcgcagaggtcattataaagcgtgtgcca
gaaacaatgccgcctgaaatcttcgcaaaagctggcggtaaaacgcaaaacgcaccggtt
gccaccccacaggagctggcggattacgatgccattatttttggtacgccaacccggttt
ggcaatatgtcaggccagatgcgtaccttcctggatcaaaccggtggactgtgggcatcc
ggcgcgctatacggcaagctcggcagcgtgttcagttctaccggaacgggcggtggccag
gagcagaccatcacctcgacctggactacgcttgcccatcatgggatggtgattgtcccg
ataggctatgccgcacaggaactgtttgacgtctcccaggttcgcggcggcacgccttac
ggcgcaacgactatcgccggaggcgacggttcacgtcaaccaagccaggaggaactctct
atcgctcgctatcagggggaatacgtcgccggtctggcagtcaaactcaacggctaa

DBGET integrated database retrieval system