KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1939
Entry
SPUL_1939         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: YccJ
Other DBs
NCBI-ProteinID: AET54267
Position
1932734..1932961
AA seq 75 aa
MPTQEAKAHRVGEWASLRNTSPEIAEAIFEVAHYDEKLAEKIWEEGSDEVLIKAFEKTDK
DSLFWGEQIIERKNV
NT seq 228 nt   +upstreamnt  +downstreamnt
atgccaactcaagaagcaaaagcgcaccgcgtcggcgaatgggcaagcctgcgtaatacg
tcgccggaaattgccgaagccatttttgaagtcgctcactatgacgagaaactggcagaa
aaaatatgggaagaaggtagcgatgaggtgctgatcaaagcctttgagaaaacggacaaa
gactcgctcttctggggcgaacaaatcatcgaacgtaaaaacgtataa

DBGET integrated database retrieval system