KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1940
Entry
SPUL_1940         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00010  Glycolysis / Gluconeogenesis
sel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPUL_1940
Enzymes [BR:sel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SPUL_1940
SSDB
Motif
Pfam: His_Phos_2
Other DBs
NCBI-ProteinID: AET54268
Position
complement(1932995..1934236)
AA seq 413 aa
MKKSLLAVAVAGAVLLSSAVQAQTTPEGYQLQQVLMMSRHNLRAPLANNGSVLAQSTPNA
WPAWDVPGGQLTTKGGVLEVYMGHYTREWLVAQGLIPSGECPAPDTVYAYANSLQRTVAT
AQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFRQQAVQAMEKARSQLHLDES
YKLLEQITHYQDSPSCKEKHQCSLIDAKDTFSANYQQEPGVQGPLKVGNSLVDAFTLQYY
EGFPMDQVAWGGIHTDRQWKVLSKLKNGYQDSLFTSPTVARNVAAPLVKYIDKVLVADRV
SAPKVTVLVGHDSNIASLLTALDFKPYQLHDQYERTPIGGQLVFQRWHDGNANRDLMKIE
YVYQSARQLRNAEALTLKSPAQRVTLELKGCPVDANGFCPLDKFDNVMNTAAK
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaaaaaatcattactcgctgttgctgtggcaggggctgttttgttgtcatccgccgta
caggcgcagacaacgccggagggttatcaattacaacaggtgctgatgatgagccgccat
aatctgcgggcgccgctggcgaataatggcagcgtactggcgcagtcgacgccgaacgcc
tggccggcgtgggacgttcccggcgggcaactgacgacgaaaggcggcgtgctggaagtc
tatatgggacattacacacgtgaatggctggtcgcgcaggggctgataccgtcgggagaa
tgtccggcgcccgacacggtatatgcctatgcgaatagtttgcagcgcaccgtcgccacc
gcgcaatttttcattaccggcgctttccccggctgtgatattcctgttcatcatcaggaa
aaaatgggcactatggaccctaccttcaatccggtgattaccgatgattccgccgcgttc
cggcaacaggccgtacaggcgatggaaaaggcgcgtagtcagctacatcttgatgagagt
tataaactgcttgagcagataacgcattatcaggactcgccgtcctgcaaagagaagcat
cagtgttcgctaatcgacgcgaaagataccttcagtgcgaactatcagcaagagcctggc
gtgcaggggccgctgaaagtggggaactcgctggtggatgcgtttaccctgcaatattac
gaagggtttccgatggatcaggtcgcctggggcgggatccacaccgatcggcagtggaag
gtgctgtcaaaactgaaaaacggctaccaggacagcctgtttacctcacccacggtggca
cgcaatgtcgctgcgccgctggtgaaatatatcgataaggtgctggttgccgatcgcgtt
agcgcgccgaaggttaccgtgctggtggggcatgattccaatatcgcgtcgctgctgacg
gcgctggattttaaaccctatcagctccatgaccagtatgagagaacgccgattggcggt
cagcttgtcttccaacgctggcatgacggcaacgctaaccgggatttgatgaaaatcgag
tatgtctaccagagcgcccggcagttacgcaatgcggaagcgttaacgctcaaatcgccc
gcgcaaagggtaaccctggaactgaaaggatgtccggtggatgcgaacggcttctgtccg
ctggataagttcgataatgtcatgaacactgctgcaaaatag

DBGET integrated database retrieval system