KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1941
Entry
SPUL_1941         CDS       T01740                                 

Gene name
scsD
Definition
(GenBank) secreted protein, suppressor for copper-sensitivity D
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: Redoxin AhpC-TSA Thioredoxin Thioredoxin_8 Thioredoxin_2 TraF Thioredoxin_9 Thioredoxin_7
Other DBs
NCBI-ProteinID: AET54269
Position
complement(1934369..1934875)
AA seq 168 aa
MAAKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLHTLTGESTTLATLSEER
PVLLYFWASWCGVCRFTTPAVARLAAEGENVMTVALRSGDDAEVARWLARKGVDFPVVND
AKGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKLRLWWAKTF
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcggctaaactgcggcgttggctgcgtgaagccgcggtttttctggcgctcctcatc
gcgataatggtggtcatggacgtctggcgcgcgccgcaggcgcctccggcgtttgccgcg
acaccgttacatacgctgacgggagagtcgacaactctggcgaccttgagcgaagaacgc
cccgtactgctctatttttgggccagctggtgcggggtatgccgctttactacgcctgcg
gtcgctcgcctggcggctgaaggggaaaacgtcatgaccgttgcgctccgctccggcgat
gacgctgaggttgcccgctggctggcgcgcaagggcgttgacttcccggtcgtcaatgat
gctaaaggcgccttatccgctggctgggaaatcagcgtgacaccaacgctggtggtggtt
tcacaaggtcgggttgtgttcaccaccagcggctggaccagctattggggcatgaagctt
cggctgtggtgggcaaaaacgttctga

DBGET integrated database retrieval system