KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1942
Entry
SPUL_1942         CDS       T01740                                 

Gene name
scsC
Definition
(GenBank) secreted protein, suppressor for copper-sensitivity C precursor
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_2 Thioredoxin Thioredoxin_3 TraF Thioredoxin_8
Other DBs
NCBI-ProteinID: AET54270
Structure
PDB: 
4GXZ

Position
complement(1934865..1935488)
AA seq 207 aa
MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVN
FTDYNCPYCKQLDPMLEKIVQKYPDVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLA
LHEKLMQKRGYHTDDSIKQSQQKAGATPVTLDEKSMETIRTNLQLARLVGVQGTPATIIG
DELIPGAVPWDTLEAVVKEKLAAANGG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaaatacatgattgttttactgctggcgctgttttcaacgctgagcatcgcgcaagaa
accgctccttttacgcccgatcaggaaaagcagattgaaaatctgatccatgcggcgttg
tttaacgatcctgccagcccgcggataggcgctaaacaccctaagctgacgctggtgaac
tttacggattacaactgcccgtactgcaaacagctcgatccgatgctggaaaagattgtg
cagaaatatcctgacgttgcggtcattattaaaccgctgccattcaaaggagagagttcc
gtactggcggcgcgtattgcgctgaccacctggcgcgagcatccgcaacagttcctcgcg
ctacatgaaaaactcatgcaaaagcgcggttaccatacggatgacagtattaaacagtcc
cagcagaaagcaggggctacgccagtgactctggatgaaaaaagcatggaaacgatacgc
actaatttgcagttggcaaggctggtcggcgtgcaaggaacgccagcgacgatcattggc
gacgagctgattccgggcgcggtgccctgggatacgctggaagcggtggtgaaagaaaaa
ctggcggctgccaatggcggctaa

DBGET integrated database retrieval system