KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1943
Entry
SPUL_1943         CDS       T01740                                 

Gene name
scsB
Definition
(GenBank) membrane protein, suppressor for copper-sensitivity B precursor
  KO
K08344  suppressor for copper-sensitivity B
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_1943 (scsB)
Transporters [BR:sel02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   SPUL_1943 (scsB)
SSDB
Motif
Pfam: DsbC Thioredoxin_7 DsbD Thioredox_DsbH Thioredoxin Thioredoxin_2
Other DBs
NCBI-ProteinID: AET54271
Position
complement(1935485..1937371)
AA seq 628 aa
MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANGETRLLLDVKLEN
GWKTYWRAPGEGGVAPSIAWKGDMPEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGT
PPATLSGVLTLSTCSNVCLLTDYPFSVTATVQNADFAHDYARAMGKVPLRSGLTDSLDVG
YRPGELVVTATRAAGWSSPGLYLDTIDDVDFAKPRLRVEGDRLQATVPVTDSWGEKAPDL
RNKSLTLVLADGAIAQESTQTIGAAPAQTPDNAALPFWQVVMMALIGGLILNLMPCVLPV
LGMKLGSILLVEEKSRSHIRRQFLASVAGIIASFMALAAFMTLLRLSNHALAWGVQFQNV
WFIGFMALVMLLFSASLFGLFEFRLPSSMTTKLATYGGNGMSGHFWQGAFSTLLATPCSA
PFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVAIRPGLALRLPRPGRWMNVLRRIL
GLMMLGSAIWLATLLLPHFGFTASKSAQDTVQWQPLSEQAIQSALAQHKRVFVDVTADWC
ITCKVNKYNVLQKEDVQAALQQPDVVALRGDWTLPSDAITDFLKTRGQVAVPFNQVYGPG
LPEGEALPTLLTRDAVLQTLKKAKGITQ
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgatgattttattcaggcggatactgttctgcctgttatggctttggctgcccgtctcc
tgggcggcggaaagcggctggctgcgttcgcccgataacgaccatgccagcatacggcta
cgtgccgatacgtccgctaacggtgagacccggctgttgcttgacgtcaaactggaaaac
ggctggaaaacctactggcgcgcgccgggggaagggggcgtggcgccctctatcgcctgg
aaaggtgacatgcctgaggtaagctggttctggccaaccccctcgcgctttgatgtggcg
aatatcaccacccagggatatcacgacgaggtgacctttccgatgatcgtgcgcggtacg
ccgcccgcgaccttgagcggcgtgttgacgttatcaacctgcagcaatgtttgtctgttg
accgattaccccttttccgtgacggccactgtgcagaatgccgattttgcccatgactat
gcgcgggcgatgggtaaagttccgctccgcagtggactaacggactcgcttgacgtcggc
tatcgcccgggagaactggtggtcactgctacgcgagcggcgggctggtcatcgcccggg
ctctatcttgacaccatagatgacgtcgattttgcgaagcctcgcctgcgcgtagagggc
gacaggttacaggcgacggtgccggtgacggacagttggggcgaaaaggcgcccgatttg
cgcaacaaatcgctgaccctcgtgttagccgatggcgctatcgcccaggagagcacgcaa
accattggcgctgcgccagcgcaaacgccggacaatgcggcgctacctttctggcaagtt
gtaatgatggcgctgatcggcggactgattcttaatttaatgccctgcgtactgccggtt
ctgggcatgaaacttggctctattttattggtagaggaaaaaagccgctctcacatcagg
cgacaatttttggcttcggtcgccggtatcattgcgtcatttatggcgctggcggcgttt
atgaccctccttcgcctgtcaaaccatgcgctggcttggggagtccagttccagaatgta
tggtttattggttttatggcgctggtgatgttgttgtttagcgccagcctgttcgggctt
tttgagttcaggcttccctcatctatgaccacgaaactggccacttacggcggtaacggt
atgtcgggacatttctggcagggggcattctccacgctgctggcgacgccttgtagcgcg
ccgtttctgggcacggcggtcgcggtggcgctcacggcgtcgttgccgacgctgtggggg
ctgttccttgcgctaggcctggggatgagcgcgccgtggctactggtcgcgatacgacca
gggcttgcgctacgtttaccgcgccccgggcgttggatgaatgtcctgcgtaggatcctc
ggtctgatgatgctggggtcggctatctggctggcgacgttactcctgccgcatttcggc
ttcactgcgtcaaagagcgcgcaagacacggttcagtggcaaccgttgagtgaacaggca
atccagtcggcgctggcgcagcataagcgggtatttgtcgatgtcactgcggactggtgt
attacctgtaaagtgaataaatacaacgtcctgcaaaaagaagatgtgcaggccgccttg
caacaaccggatgttgtggcgctgcggggagactggacgctgccgtccgatgccattaca
gattttctgaaaacgcgtggccaggtcgccgtgccgtttaatcaggtatatggccccggc
ttgccggaaggggaggcactgcccactttgctgacccgcgatgcggtattacaaacgttg
aaaaaagcgaaaggaataacccaatga

DBGET integrated database retrieval system