KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1944
Entry
SPUL_1944         CDS       T01740                                 

Gene name
scsA
Definition
(GenBank) membrane protein, suppressor for copper-sensitivity A
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: Chloroplast_duf
Other DBs
NCBI-ProteinID: AET54272
Position
complement(1937420..1937782)
AA seq 120 aa
MAKQQRMGWWFLCLACVVVMVCTAQRMAGLHALQMQATASAAVISAPSSTDDGSPVTPCE
LSAKSLLAAPPVLFEGAILALCLLLSLLAPVRVMRLPFSPPRAISPPTLRVHLRFCVFRE
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcgaaacaacaacggatgggctggtggtttctttgccttgcatgtgtcgtggtaatg
gtttgtaccgcgcaacgcatggcgggcctgcacgccttgcagatgcaggcgacggcctct
gctgcggtgatcagcgctccctcctcgacagatgacggctcgccggtcaccccctgcgaa
ttaagcgccaagtcgctgctggcggcgcctccggtactctttgaaggcgctatccttgcg
ctttgtctactgctttccttactggcgcctgtccgggtcatgcgcctgccgttttcgcct
ccacgggctatttcgccgcccacattacgggtacatctacgattttgtgtcttccgtgaa
tga

DBGET integrated database retrieval system