KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1945
Entry
SPUL_1945         CDS       T01740                                 

Gene name
cbpA
Definition
(GenBank) curved DNA-binding protein
  KO
K05516  curved DNA-binding protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sel03110]
    SPUL_1945 (cbpA)
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_1945 (cbpA)
Chaperones and folding catalysts [BR:sel03110]
 Heat shock proteins
  HSP40 / DNAJ
   SPUL_1945 (cbpA)
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    SPUL_1945 (cbpA)
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-ProteinID: AET54273
Position
1938018..1938938
AA seq 306 aa
MELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFNEVAEAWEVLSDEQ
RRAEYDQLWQHRNDPQFNRQFQQHEGQPYNAEDFDDIFSSIFGQHGRHSHHRHAARGHDI
EIEVAVFLEETLEEHQRTISYSVPVYNAFGLVEREIPKTLNVKIPAGVSNGQRIRLKGQG
TPGENGGPNGDLWLVIHIAPHPLFDIVNQDLEVVLPLAPWEAALGAKVSVPTLKERILLT
IPPGSQAGQRLRIKGKGLASKKHTGDLYAIIKIVMPPKPDEKTAALWQQLADAQSSFDPR
QQWGKA
NT seq 921 nt   +upstreamnt  +downstreamnt
atggaacttaaggattattacgccattatgggcgtgaaaccgacggacgatctcaagacg
attaagaccgcctatcgccgactggcccgcaagtaccatccagatgtcagcaaagaaccc
gatgccgaagcccgtttcaacgaggttgctgaagcatgggaagtgctgagtgatgagcaa
cggcgcgccgagtatgaccagttatggcaacaccgtaacgatccacaatttaatcgccag
ttccagcaacacgaaggccagccgtataacgctgaagattttgatgatattttctcgtct
atttttggtcagcacggtcgccattcgcatcaccgccacgccgcacgcggtcatgatatc
gaaattgaagtggcggtattcctggaagaaacgctggaagagcaccagcgtacgattagc
tattccgtccccgtttataacgcgttcggcctggtggagcgggaaattcccaagacattg
aatgtgaaaatcccggctggcgtcagcaacgggcaacgaatcagactgaaaggccagggc
acgccgggggaaaacggcggacctaatggcgatttatggctcgttatccatattgccccg
catccgctctttgatattgtcaatcaggatctggaagtcgtccttccgcttgccccatgg
gaggcggcgctcggcgctaaggtgtctgtgccaacgcttaaagagcgtattttgctgacc
attccccccggtagccaggcaggtcagcggctgcgtatcaaaggaaaaggattagccagt
aaaaagcacactggcgatctctatgccatcatcaaaatcgttatgccgccgaaacctgac
gagaaaacagctgccctgtggcaacaactggcggacgcgcagtcgtcctttgacccacgc
cagcaatgggggaaagcataa

DBGET integrated database retrieval system