KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1946
Entry
SPUL_1946         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K18997  chaperone modulatory protein CbpM
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_1946
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    SPUL_1946
SSDB
Motif
Pfam: MerR_2
Other DBs
NCBI-ProteinID: AET54274
Position
1938938..1939243
AA seq 101 aa
MANITVTFTITEFCLHTGVTEEELNEIVGLGVIEPYEDDNADWQFDDRAASVVQRALRLR
EELALDWPGIAVALTLLEENSRLREENRLLLQRLSRFISHP
NT seq 306 nt   +upstreamnt  +downstreamnt
atggctaacatcactgtcacctttaccatcaccgaattttgtttgcacaccggcgtgacg
gaagaggagctaaacgaaatcgtcggacttggcgtaattgagccttacgaagacgataac
gccgactggcaattcgacgatcgcgcagcgagcgtggtacaacgcgcgctacgcttacgt
gaggagctggcgctcgactggcctgggatcgcggtcgcgttaacgctgctggaagagaat
tcacggctgcgcgaagaaaaccggttactactgcaacgcctttctcgctttatctcgcat
ccctaa

DBGET integrated database retrieval system