KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1948
Entry
SPUL_1948         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: Lactamase_B_2 Lactamase_B Lactamase_B_6
Other DBs
NCBI-ProteinID: AET54276
Position
complement(1940667..1941584)
AA seq 305 aa
MLAVCMLAQSHLAIAASAPAPQEINIVLLGTKGGPSLLNTARLPQATALTIGDKIWLIDA
GYGASLQLVKNGIPLRNINTILLTHLHSDHILDYPSLLMNAWASGLKDHTIQVYGPPGTQ
AMTKASWKVFDRDITLRMEEEGKPDPRNLVKATDIGQGVIYKDELVTISALKVPHSPFPD
GEAFAYRFDTQGKRIVFSGDTSWFPPLATFAQGADILVHEAVHVPSVAKLANSIGNGKTL
AEAIASHHTTIEDVGKIAREAHVKKLVLSHLVPATVADDVWQQEAMKNYPGPVIVGHDNM
TISVP
NT seq 918 nt   +upstreamnt  +downstreamnt
atgctggcggtttgtatgctggcgcaaagccaccttgccattgctgccagtgctcctgcg
cctcaagagatcaacattgttttactgggcaccaaaggcgggccttctttgctcaataca
gccagactaccgcaagcgacagcgctcactatcggcgataaaatatggctgatagatgcc
ggctacggcgccagtctgcaactggtgaaaaacggcattccactgcgcaacatcaatact
attttgctcacccatctgcacagcgaccacatactggattatccttccttgctgatgaat
gcctgggcaagtggcctgaaagaccataccatacaggtgtatggcccgccgggaacccag
gcgatgacgaaggctagctggaaggtctttgacagggatatcacgctacgcatggaagaa
gaggggaaacccgatccgcgcaacctggttaaggcgaccgatattggtcagggcgtcatc
tataaagatgaactggttacaataagcgcgctgaaagtgcctcattcccctttcccggac
ggtgaagcgtttgcttaccgttttgatacccagggtaagcgaatcgtcttctctggcgat
acgtcctggtttccgccgcttgcaacgtttgcccaaggggcggatatcctggtacatgag
gcggtacatgtcccctcggtagcaaaactggctaatagtattggcaacggaaaaacgctg
gctgaagcgattgcgtcgcatcacaccacgattgaagatgtcggtaagattgctcgcgag
gcccacgtgaaaaaactggtgttaagtcatctggtgcctgcgacggttgcggatgacgtc
tggcaacaggaagccatgaaaaattacccgggccctgtcattgtcggtcatgacaatatg
acgataagcgtaccgtaa

DBGET integrated database retrieval system