KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1949
Entry
SPUL_1949         CDS       T01740                                 

Gene name
hpaA
Definition
(GenBank) 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein
  KO
K02508  AraC family transcriptional regulator, 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sel03000]
    SPUL_1949 (hpaA)
Transcription factors [BR:sel03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    SPUL_1949 (hpaA)
SSDB
Motif
Pfam: HTH_18 Cupin_2 AraC_binding HTH_AraC AraC_binding_2 tRNA-synt_2
Other DBs
NCBI-ProteinID: AET54277
Position
complement(1941620..1942516)
AA seq 298 aa
MCQRAIANIDISKEYDESMGSNDVHYQSFARMADFFGRDMQAHRHDQFFQMHFLDTGQIE
LQLDDHRYSVQAPLFVLTPPSVPHAFITESDSDGHVLTVREELVWPLLEVLYPGTREAFG
LPGICLSLADKPNELAALKHYWQLIERESTEQLAGCEHTLVLLAQAVFTLLLRNAKLDDH
AATGMRGELKLFQRFTLLIDNHFHQHWTVPDYACELHITESRLTDICRRFANRPPKRLIF
DRQLREAKRLLLFSDNAVNEIAWQLGFKDPAYFARFFNRLAGCSPSQFRQREVPSFLN
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtgccaacgtgcgatcgccaatattgatatcagcaaagagtatgacgaaagcatgggc
agtaacgatgtgcattatcagtcgtttgctcgtatggcggatttctttggtcgtgatatg
caggcgcatcgccacgaccagttttttcaaatgcactttcttgataccgggcagattgag
ctacagctcgacgatcatcgctattcggtgcaggcgccgctatttgtgctaacgccgccc
tcggtgccgcatgcttttattaccgaatcggatagcgatggtcatgttctgacggtacgc
gaagagctggtttggccgctgctggaagtgctttatcccggcaccagagaggccttcggc
ctgccgggaatctgtctgtcgctggcggataaacccaacgagctggcggcgctcaaacat
tactggcagctaattgagcgggagtccacggaacaactggctggctgcgaacataccctg
gtgctactggcgcaggcggtatttaccttgctgttgcgtaatgcgaagctggacgatcac
gccgcaaccgggatgcgcggtgaactgaaactttttcagcgctttaccctgttaattgac
aaccacttccatcagcactggacggtgcccgattatgcctgtgagttgcatattaccgaa
tctcgtttgaccgatatttgccgccgttttgctaatcgcccgcctaaacgcctgattttt
gatcggcaattacgcgaggcgaaacgactgctgcttttttccgacaatgctgtcaacgag
atcgcctggcaattaggttttaaagatccggcttatttcgcccgtttctttaatcgcctt
gctggctgttctccttcgcagtttcgccaacgtgaagttccctcttttctcaactaa

DBGET integrated database retrieval system