KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1950
Entry
SPUL_1950         CDS       T01740                                 

Gene name
hpaX
Definition
(GenBank) putative 4-hydroxyphenylacetate permease
  KO
K02511  MFS transporter, ACS family, 4-hydroxyphenylacetate permease
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_1950 (hpaX)
Transporters [BR:sel02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    SPUL_1950 (hpaX)
SSDB
Motif
Pfam: MFS_1 ATG22
Other DBs
NCBI-ProteinID: AET54278
Position
complement(1942526..1943902)
AA seq 458 aa
MSDTSSALPESPESVRSHNALSTGQQTVINKLFRQLIVFLFVLFIFSFLDRINIGFAGLT
MGQDLGLSATMFGLATTLFYATYVIFGIPSNVMLSIVGARRWIATIMVLWGIASTATMFA
VGPKSLYVLRMLVGITEAGFLPGILLYLTYWFPAFFRARANALFMIAMPATTALGSIVSG
YILSLDGIFNLHGWQWLFLLEGFPSVLLGIMVWFYLDDTPAKAKWLTAEDKKCLQEMMDN
DRLTLVQPEGAISHNAMQQRSLWREVFTPIVLMYTLAYFCLTNTLSAISIWTPQILKSFN
EGSSNITIGLLAAIPQICTILGMIYWSRHSDKHQERKHHTALPFLFAAAGWLLASATDHN
LIQLLGIVMASTGSFSAMAIFWTTPDQSISLRARAIGIAVINATGNIGSALSPFMIGWLK
DITGSFNSGLWFVASLLVVGAAIIWLIPMKASRPRATP
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgagcgacacatcatctgcacttccggaaagccccgagtctgtccgttcgcacaacgcg
ctcagcacgggtcaacaaaccgtcataaataaactgttccgccaactgatcgtattttta
ttcgtgttgtttatcttctcgtttttagaccgtatcaacatcggttttgccgggttgacg
atggggcaggatctggggttaagcgccaccatgtttggccttgccacgacgctgttttac
gccacctacgtcattttcggcattcccagcaacgtgatgttgagcattgtcggcgcccgc
cgctggattgcgaccattatggtgctatggggcattgcatctaccgccacgatgttcgcg
gtgggaccgaaaagcctgtatgtgctgcgaatgctggtgggcattaccgaagcgggcttt
ttgccaggaatactgctctatttaacctactggttcccggcatttttccgcgcccgcgcc
aacgcattatttatgattgccatgccggccactaccgcgttggggtcgattgtctccggc
tatattttatcgctggacggcatattcaatctgcatggatggcagtggttattcctgttg
gaaggatttccgtcagttttgttaggcattatggtctggttttacctggatgataccccg
gcaaaagccaaatggctgacggcagaggataaaaaatgtttgcaggagatgatggataat
gaccgcctgacgctggttcagccggagggggccatcagccataacgccatgcagcagcgt
agtctgtggcgcgaagtattcacgccaattgtactgatgtatacgttggcctatttttgc
cttaccaatacgcttagcgccattagtatctggacgccgcaaatcctgaaaagttttaat
gaaggcagcagcaatatcaccatcggcctgctggcggcgatcccgcagatttgtactatt
ctgggcatgatttactggagccgccattcggacaaacatcaggaacgtaaacatcacacg
gcgttgccgttcctgtttgccgccgcgggctggctgctggcgtcggcgaccgaccataac
ctgatccagctcctggggatcgtgatggcatccacgggttcctttagcgcgatggcgatc
ttctggaccacgccggatcagtcgatcagtttacgcgccagggcgataggcattgcggtc
atcaatgccaccggcaatattggctccgcgctcagcccgtttatgattggctggctaaaa
gatatcaccggtagcttcaatagcggcctctggtttgtcgcttctctgttagtcgtcggc
gccgccattatctggcttattcccatgaaagcatcgcgtccgcgcgccaccccttga

DBGET integrated database retrieval system