KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1952
Entry
SPUL_1952         CDS       T01740                                 

Gene name
hpaH
Definition
(GenBank) 2-oxo-hepta-3-ene-1,7-dioic acid hydratase
  KO
K02509  2-oxo-hept-3-ene-1,7-dioate hydratase [EC:4.2.1.-]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00350  Tyrosine metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SPUL_1952 (hpaH)
Enzymes [BR:sel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     SPUL_1952 (hpaH)
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-ProteinID: AET54280
Position
complement(1944776..1945579)
AA seq 267 aa
MLDKQTHTLIAQRLNQAEKQREQIRAVSLDYPNITIEDAYAVQREWVNIKIAEGRTLKGH
KIGLTSKAMQASSQISEPDYGVLLDDMFFHDGGDIPTDRFIVPRIEVELAFVLAKPLRGP
HCTLFDVYNATDYVIPALELIDARSHNIDPETQRPRKVFDTISDNAANAGVILGGRPIKP
DELDLRWISALLYRNGVIEETGVAAGVLNHPANGVAWLANKLAPYDVQLEAGQIILGGSF
TRPVPASKGDTFHVDYGNMGAISCRFV
NT seq 804 nt   +upstreamnt  +downstreamnt
atgctcgataaacagacccataccctgatcgcccagcgacttaatcaggctgaaaaacag
cgtgaacaaattcgcgcagtgtcgctggattatcccaacatcactattgaagatgcctat
gccgtacagcgtgaatgggtcaatatcaagatcgccgaagggcgcacgctcaaaggccac
aaaatcggcctgacctcaaaagcgatgcaggccagctcgcaaatcagcgaaccggattac
ggcgtgctgcttgacgatatgttcttccatgacggcggcgatatccccaccgaccgtttt
atcgtcccgcgtattgaagtggagctggcgttcgtgctggcgaaaccgctgcgcggccct
cactgcacgctgttcgacgtctacaacgccacggattatgtgattccggcgctggaactg
attgacgcccgcagccacaacatcgacccggaaacccagcgcccgcgcaaagtgttcgac
accatttccgacaacgccgccaacgccggggtgatcctcggtggtcgccccatcaaacca
gacgagctggatctgcgctggatctccgcgctgctctatcgcaacggcgtgatcgaagaa
accggcgtcgccgcaggcgtgctgaatcatccggccaacggcgtggcgtggctggcgaac
aagcttgccccctacgatgtccagcttgaagccgggcagatcatcctcggcggctcgttc
acccgcccggtgccggcgagcaagggcgacaccttccatgtcgattacggcaacatgggc
gcgatcagttgccggtttgtgtaa

DBGET integrated database retrieval system