KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1953
Entry
SPUL_1953         CDS       T01740                                 

Gene name
hpaF
Definition
(GenBank) 5-carboxymethyl-2-hydroxymuconate delta-isomerase
  KO
K01826  5-carboxymethyl-2-hydroxymuconate isomerase [EC:5.3.3.10]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00350  Tyrosine metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
sel01220  Degradation of aromatic compounds
Module
sel_M00533  Homoprotocatechuate degradation, homoprotocatechuate => 2-oxohept-3-enedioate
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SPUL_1953 (hpaF)
Enzymes [BR:sel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.10  5-carboxymethyl-2-hydroxymuconate Delta-isomerase
     SPUL_1953 (hpaF)
SSDB
Motif
Pfam: CHMI
Other DBs
NCBI-ProteinID: AET54281
Position
complement(1945722..1946102)
AA seq 126 aa
MPHFIAECTENIREQADLPGLFSKVNEALAASGIFPIGGIRSRAHWLDTWQMADGKHDYA
FVHMTLKIGTGRSLESRQEVGEMLFGLIKAHFADLMENRYLALSFEIAELHPTLNYKQNN
VHALFK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccgcactttattgctgaatgtactgaaaatattcgcgagcaggctgatttacccggc
ctgttcagcaaggtaaacgaggcgctggccgccagcgggattttccctatcggcggtatc
cgcagtcgcgcccactggctggatacctggcagatggctgacggtaagcatgattacgcg
tttgtgcatatgacgctgaaaatcggtaccgggcgcagcctggagagccgtcaggaagtc
ggcgaaatgctgtttgggctgattaaagcccacttcgccgacctgatggagaaccgctat
ctggcgctgtcgtttgagattgccgagctacatccgacgctcaattacaaacaaaacaac
gtacacgcgttatttaaatag

DBGET integrated database retrieval system