KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1954
Entry
SPUL_1954         CDS       T01740                                 

Gene name
hpaD
Definition
(GenBank) 3,4-dihydroxyphenylacetate 2,3-dioxygenase
  KO
K00455  3,4-dihydroxyphenylacetate 2,3-dioxygenase [EC:1.13.11.15]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00350  Tyrosine metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
sel01220  Degradation of aromatic compounds
Module
sel_M00533  Homoprotocatechuate degradation, homoprotocatechuate => 2-oxohept-3-enedioate
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SPUL_1954 (hpaD)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.15  3,4-dihydroxyphenylacetate 2,3-dioxygenase
     SPUL_1954 (hpaD)
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: AET54282
Position
complement(1946112..1946963)
AA seq 283 aa
MGKLALAAKITHVPSMYLSELPGKNHGCRQAAIDGHIEIGKRCREMGVDTIIVFDTHWLV
NSAYHINCADHFQGVYTSNELPHFIRDMTYDYDGNPELGHLIADEAVKLGVRAKAHNIPS
LKLEYGTLVPMRYMNSDKHFKVVSISAFCTVHDFADSRRLGEAILKAIEKYDGTVAVFAS
GSLSHRFIDDQRAEEGMNSYTREFDHQMDERVVKLWREGKFKEFCTMLPEYADYCYGEGN
MHDTVMLLGMLGWDKYDGKVEFITDLFASSGTGQVNAVFPLPA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgggcaagttagcgttagcagcaaaaattacccacgtgccgtcgatgtatctttctgaa
ctgccgggaaaaaatcacggttgtcgtcaggcagccattgatgggcatattgaaattggc
aagcgttgccgcgaaatgggcgttgacaccattatcgtattcgacacccactggctggtg
aatagcgcttaccacattaattgtgccgaccatttccagggcgtctataccagcaacgaa
ttgccacactttattcgcgacatgacctatgactatgacggcaatccggagctcggccac
ctgatcgccgacgaggcagtcaaactgggcgtgcgcgctaaagcgcataacatcccgagc
ctgaagctggagtatggcacgctggtaccgatgcgctacatgaacagcgacaagcacttc
aaagtggtctccatctcggcgttctgcactgtgcatgattttgccgacagccgcagactg
ggcgaagccattctcaaggcgattgagaaatatgacggtaccgtagcggtattcgccagt
ggttctctgtcgcaccgttttattgacgaccaacgggcggaagaggggatgaacagctac
acccgcgagttcgatcatcaaatggacgagcgtgtggtcaagctgtggcgcgaaggaaaa
ttcaaggagttttgcaccatgttgccggagtacgccgactactgctacggcgaaggcaac
atgcacgacacggtcatgctgctgggaatgctgggttgggacaaatacgacggcaaggtg
gagttcatcaccgacctgttcgccagctccggtaccggccaggtaaacgctgttttcccg
ctgcctgcgtaa

DBGET integrated database retrieval system