KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1955
Entry
SPUL_1955         CDS       T01740                                 

Gene name
hpaE
Definition
(GenBank) 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase (chms dehydrogenase)
  KO
K00151  5-carboxymethyl-2-hydroxymuconic-semialdehyde dehydrogenase [EC:1.2.1.60]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00350  Tyrosine metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
sel01220  Degradation of aromatic compounds
Module
sel_M00533  Homoprotocatechuate degradation, homoprotocatechuate => 2-oxohept-3-enedioate
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SPUL_1955 (hpaE)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.60  5-carboxymethyl-2-hydroxymuconic-semialdehyde dehydrogenase
     SPUL_1955 (hpaE)
SSDB
Motif
Pfam: Aldedh DUF3813
Other DBs
NCBI-ProteinID: AET54283
Position
complement(1946965..1948431)
AA seq 488 aa
MKKINHWINGKNVAGNDYFQTTNPATGDVLAEVASGGEAEVNQAVAAAKEAFPKWANLPM
KERARLMRRLGDLIDQNVPEIAAMETADTGLPIHQTKNVLIPRASHNFEFFAEVCQQMNG
KTYPVDDKMLNYTLVQPVGVCALVSPWNVPFMTATWKVAPCLALGNTAVLKMSELSPLTA
DRLGELALEAGIPAGVLNVVQGYGATAGDALVRHHDVRAVSFTGGTATGRNIMKNAGLKK
YSMELGGKSPVLIFEDADIERALDAALFTIFSINGERCTAGSRIFIQQSIYPEFVKRFAE
RANRLRVGDPTDPNTQVGALISQQHWEKVSGYIRLGIEEGATLLAGGAEKPTDLPAHLKG
GNFLRPTVLADVDNRMRVAQEEIFGPVACLLPFKDEAEGLRLANDVEYGLASYIWTQDVS
KVLRLARGIEAGMVFVNTQNVRDLRQPFGGVKASGTGREGGEYSFEVFAEMKNVCISMGD
HPIPKWGV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaagaaaataaatcattggattaacggcaaaaacgttgcaggtaatgactacttccag
accactaacccggcgaccggtgacgtgctggcggaagtagcctccggcggtgaagcagaa
gtgaaccaggctgtcgcggcggcaaaagaggcgttcccgaaatgggccaacctaccgatg
aaagagcgcgcgcgcctgatgcgccgccttggcgacctgattgaccagaacgtaccggaa
atcgcggcgatggaaaccgccgacaccggtctgcctattcaccagactaaaaacgtgctg
atcccgcgcgcctcgcataacttcgaattcttcgccgaagtgtgccagcagatgaacggc
aagacctatccggttgacgataaaatgctcaattatacgctggtgcagcccgtcggcgtc
tgcgcgctggtgtcgccgtggaacgtgccgtttatgaccgcgacctggaaagtcgcgccg
tgcctggcgctgggcaacaccgcggtgctcaaaatgtccgagctgtcgccgttgactgcc
gacaggttgggcgagttggcgctggaggcaggaattccggcaggcgtgctgaacgtggtg
cagggctacggcgcgacggcgggcgatgcgctggtacgccaccatgacgtgcgtgcggtg
tcgtttaccggcggtaccgccaccggtcgcaatatcatgaaaaatgccggcctgaaaaaa
tactcgatggagctgggcggcaaatcgccggtgctgatttttgaagatgccgacattgag
cgcgcgctggacgccgcgctgttcaccatcttctcgatcaacggcgaacgctgcaccgcc
gggtcgcgcatctttatccagcagagcatttaccctgagttcgtgaagcgctttgccgaa
cgcgcgaatcgcctgcgtgtcggcgatccgaccgacccgaacactcaggtcggcgcgctg
attagccaacagcactgggaaaaagtctctggctatattcgcctcggcattgaagagggc
gcaacgctgctggcgggcggtgcggaaaaacccactgacctgcctgcgcatctgaaaggc
ggtaacttcctgcgcccaaccgtgctggccgatgtcgacaaccgtatgcgcgtcgcgcag
gaagagatctttgggcccgttgcctgtctgctgccattcaaagacgaagcggaagggtta
cgcctggcgaacgacgtcgaatacggtctggcctcttatatctggacccaggacgtgagc
aaagtattgcgcctggcgcgtgggattgaagccggcatggtcttcgtcaacacccagaac
gtccgcgacctgcgccagccgttcggcggcgtgaaagcctccggtaccgggcgcgaaggc
ggcgaatatagcttcgaagtgtttgcggaaatgaaaaacgtctgcatctcaatgggcgac
catcctatcccaaaatggggagtttga

DBGET integrated database retrieval system