KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1957
Entry
SPUL_1957         CDS       T01740                                 

Gene name
hpaR
Definition
(GenBank) homoprotocatechuate degradative operon repressor
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: MarR MarR_2 TetR_C_35 DUF3116 HxlR
Other DBs
NCBI-ProteinID: AET54285
Position
1949992..1950432
AA seq 146 aa
MHDSLTIALLQAREAAMTYFRPIVKSHNLTDQQWRIVRILADSPSMDFHELAFRTCILRP
SLTGILTRMERDGLVLRLKPVNDQRKLYVMLTEQGQTLYARARSQVEEAYRKIEADFTPE
KTQQLMLLLDDLIALGRQHPDSEAEA
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcatgattcattaaccatcgccttgcttcaggcgcgcgaagcggcaatgacctatttc
cgccccatcgttaaaagccacaatctgaccgaccagcaatggcgcattgtgcgaatcctg
gccgatagcccctctatggattttcacgagctggcctttcgtacctgcattttgcgtcca
agtctgaccggaatattgacgcgcatggagcgagacggactggtgttgcgactcaagccg
gttaacgatcagcgtaagttatatgtcatgttgacggagcagggacaaacgttgtacgcc
cgtgcccgaagccaggtagaagaggcttatcgaaaaattgaggccgatttcacgcccgaa
aaaacacagcaattgatgctgctgctggacgatcttattgccctgggacgccagcatcct
gatagcgaagcggaagcatag

DBGET integrated database retrieval system