KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1958
Entry
SPUL_1958         CDS       T01740                                 

Gene name
hpaB
Definition
(GenBank) 4-hydroxyphenylacetate 3-monooxygenase
  KO
K00483  4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.9]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00350  Tyrosine metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
sel01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SPUL_1958 (hpaB)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     SPUL_1958 (hpaB)
SSDB
Motif
Pfam: HpaB_N HpaB DUF4588
Other DBs
NCBI-ProteinID: AET54286
Position
1950650..1952212
AA seq 520 aa
MKPEDFRTDNKRPLTGEEYLKSLQDGREIYIYGERVKDVTTHPAFRNAAASVAQLYDALH
KPSMQDTLCWNTDTGSGGYTHKFFRVAKSADDLRQHRDAIAEWSRLSYGWMGRTPDYKAA
FGCALGANPAFYGQFEQNARNWYTRIQETGLYFNHAIVNPPIDRHKPADEVKDVYIKLEK
ETDAGIIVSGAKVVATNSALTHYNMIGFGSAQVMGENPDFALMFVAPMDAEGVKLISRAS
YEMVAGATGSPFDYPLSSRFDENDAILVMDKVLIPWENVLIYRDFDRCRRWTMEGGFARM
YPLQACVRLAVKLDFITALLKKSLECTGTVEFRGVQADLGEVVAWRNMFWALSDSMCSEA
TPWVNGAWLPDHAALQTYRVMAPMAYAKIKNIIERNVTSGLIYLPSSARDLNNPQIDQYL
AKYVRGSNGMDHVERIKILKLMWDAIGSEFGGRHELYEINYSGSQDEIRLQCLRQAQSSG
NMDKMMAMVDRCLSEYDQNGWTVSHLHNNDDINQLDKLLK
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgaaacctgaagattttcgtactgataacaagcgtccgttaacgggcgaagagtattta
aaaagcctgcaggacgggcgggaaatttatatttacggcgaacgcgttaaagatgttacg
acacatccggcattccgcaatgccgcagcctctgtcgcacaactgtatgacgcattacat
aaaccgtcgatgcaagataccctatgctggaataccgataccggcagcggcggttatacg
cataaatttttccgcgttgcgaaaagcgcagacgatctgcgccaacatcgtgatgctatc
gccgagtggtcacgcctgagttacggctggatgggacgcacaccggattacaaagccgcc
tttggttgcgccctgggcgctaacccagccttctacggccagtttgagcagaacgcccgc
aactggtacacccgtattcaggagaccggcctgtactttaaccatgcaatcgtcaacccg
cccattgaccgccacaaacctgccgacgaagtgaaagacgtctatatcaagctggagaaa
gagacggacgccgggattattgtcagcggggcgaaagtcgtcgccactaactccgccctg
actcactacaacatgattggtttcggctcagcccaggtgatgggcgaaaacccggatttc
gctctgatgtttgtcgcgccaatggatgccgaaggcgtaaaacttatttcgcgcgcctcg
tatgaaatggtcgcgggcgcgacgggctcgccgtttgattatccactctccagccgcttt
gatgaaaacgatgccattctggtgatggacaaggtgttgatcccgtgggaaaacgtgttg
atttaccgtgatttcgatcgttgccgtcgctggacgatggaaggcggctttgcccgtatg
tatccactgcaagcctgtgttcgtctggcggttaaacttgatttcattaccgcgctgctg
aaaaaatcgctcgaatgtacgggtaccgtagagttccggggcgtgcaggccgatctcgga
gaagtcgtggcgtggcgcaatatgttctgggcattgagcgattctatgtgttctgaagca
accccgtgggtaaacggcgcctggctaccggaccacgccgcgctgcaaacctatcgtgtc
atggccccaatggcctacgcgaaaattaaaaatattattgaacgtaacgttaccagcggc
ctgatttacctgccttccagcgcccgcgatctgaataatccgcaaatcgaccagtacctg
gcgaaatacgtacgcggctctaacggaatggaccatgttgaacgtatcaaaattcttaaa
ttgatgtgggatgccatcggcagcgagtttggcggtcgccatgagctgtacgagattaac
tactcgggcagccaggatgaaattcgtctgcagtgcctgcgtcaggcccagagctccggc
aatatggataagatgatggcaatggttgatcgctgcctctccgaatacgatcagaatggc
tggacggtttcgcatttgcacaataacgacgacatcaatcaactggataagctgctgaaa
taa

DBGET integrated database retrieval system