KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1959
Entry
SPUL_1959         CDS       T01740                                 

Gene name
hpaC
Definition
(GenBank) 4-hydroxyphenylacetate 3-monooxygenase coupling protein
  KO
K00484  flavin reductase (NADH) [EC:1.5.1.36]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00350  Tyrosine metabolism
sel00740  Riboflavin metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
sel01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SPUL_1959 (hpaC)
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SPUL_1959 (hpaC)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.36  flavin reductase (NADH)
     SPUL_1959 (hpaC)
SSDB
Motif
Pfam: Flavin_Reduct MSP1b
Other DBs
NCBI-ProteinID: AET54287
Position
1952230..1952742
AA seq 170 aa
MQVDEQRLRFRDAMASLAAAVNIVTTAGHAGRCGITATAVCSVTDTPPSVMVCINANSAM
NPVFQGNGKLCINVLNHEQELMARHFAGMTGMAMEERFHQPCWQNGPLGQPVLNGALAGL
EGEISEVQTIGTHLVYLVAIKNIILSQDGHGLIYFKRRFHPVRLEMEAPV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcaagtagatgaacaacgtctgcgttttcgcgatgcgatggcaagtctggcggcagcg
gtcaacatcgtaaccacggcgggtcacgccggacgctgcggtatcaccgcaacagcggtc
tgttccgtcaccgatacgccgccctccgtgatggtatgtattaatgccaatagcgccatg
aaccccgtctttcagggcaacggcaagctgtgcattaatgtacttaaccatgagcaggag
ctgatggcgcgccactttgccggtatgacggggatggcgatggaagagcgttttcaccag
ccatgttggcaaaacgggccgctgggccagccggtacttaacggcgcgctggccggtctt
gaaggcgagatcagcgaggtacaaaccattggcacgcatctggtgtatctggtggcgatc
aaaaatattattcttagccaggatgggcatggcctgatttatttcaaacgccgttttcat
ccggtcagacttgagatggaagcgcctgtttaa

DBGET integrated database retrieval system